KEGG   Pseudomonas fluorescens L228: A7318_04090Help
Entry
A7318_04090       CDS       T04730                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfx  Pseudomonas fluorescens L228
Pathway
pfx00473  D-Alanine metabolism
pfx00550  Peptidoglycan biosynthesis
pfx01100  Metabolic pathways
pfx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A7318_04090
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7318_04090
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A7318_04090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfx01011]
    A7318_04090
Enzymes [BR:pfx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A7318_04090
Peptidoglycan biosynthesis and degradation proteins [BR:pfx01011]
 Precursor biosynthesis
  Amino acid ligase
   A7318_04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 ATPgrasp_YheCD TTL ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: AOE77784
UniProt: A0A2S8XTA1
LinkDB All DBs
Position
934054..935010
Genome map
AA seq 318 aa AA seqDB search
MTTNYDALFSTLTPADFGRVAVLFGGKSAEREVSLKSGNAVLHALQSAGVNAFGIDVGDD
FLARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHSVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDAT
KEKELMDLTAKACEALGIAGWARADVMQDDQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASIEPRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaattacgacgccctattctccaccctcacgcctgccgacttcggccgtgtg
gcggtactgttcggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcaatgcc
gtgctccacgccctgcaaagcgccggtgtgaacgcgttcggcatcgacgtcggtgatgat
ttcctcgcccgcctgcaggctgagaagatcgaccgcgccttcatcatcctgcatggccgt
ggcggtgaagacggcagcatgcaaggcctgttggagtgcgctggcatcccttacaccggc
agcggcattctcgcctcggcactggcgatggacaagttgcgcaccaagcaggtatggcac
agcctgggtattccaaccccgcgtcacagtgtgctgtgcagcgaagacgattgtatttct
gcagccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggccaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgattcgcaagtgttggtggaacagtggatccagggtcccgagtacaccatcgccacc
ctgcgtggccaggttttaccgcctatcgcattgggcacgccccacaccttctacgactac
gacgccaaatacctggcttccgatacccagtaccggatcccatgtggcctggacgcaacc
aaggaaaaagaattgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tgggcgcgggcagacgtgatgcaggatgaccaagggaatttctggttcctggaagtcaac
accgctcccggcatgaccgaccacagcctggtacctatggccgcccgtgccgccggcctg
gatttccagcagttggtgctggcgatcctggccgcaagcatcgagcctcgaggctaa

DBGET integrated database retrieval system