KEGG   Pseudomonas fluorescens L228: A7318_05780Help
Entry
A7318_05780       CDS       T04730                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pfx  Pseudomonas fluorescens L228
Pathway
pfx03030  DNA replication
pfx03410  Base excision repair
pfx03420  Nucleotide excision repair
pfx03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pfx00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A7318_05780
   03410 Base excision repair
    A7318_05780
   03420 Nucleotide excision repair
    A7318_05780
   03430 Mismatch repair
    A7318_05780
Enzymes [BR:pfx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A7318_05780
    6.5.1.6  DNA ligase (ATP or NAD+)
     A7318_05780
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     A7318_05780
DNA replication proteins [BR:pfx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    A7318_05780
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     A7318_05780
DNA repair and recombination proteins [BR:pfx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     A7318_05780
   NER (nucleotide excision repair)
    Other NER factors
     A7318_05780
   MMR (mismatch exicision repair)
    Other MMR factors
     A7318_05780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AOE78112
UniProt: A0A1B3DLE2
LinkDB All DBs
Position
complement(1311555..1313189)
Genome map
AA seq 544 aa AA seqDB search
MKAFAELYANLDATTSSNAKLAALQAYFRQAAPEDAAWAVYFLSGGRPRQLVPTRLLRDM
ATEASGIEPWLFEESYQSVGDLAETISLLLPESPYTSEDGLAVWLEEKLLPLRGLPPLEL
AERLPALWAQLDQPSLMVCIKLITGSFRVGVSKLLVTRALAAMADLDSKRVAQRLVGYTD
LSNRPTPEGYLKLIAAESSDEHAQRGGQPYPFFLAHGLAQPVEQFDALLGASSDWQVEWK
WDGIRAQLVKREGRLWIWSRGEELVTERFPELHSLVSGLPDGTVIDGEIVVWKDAVQPFA
LLQQRIGRKTLSKKVLEDAPVAVLAYDLLEHEGDDWRNHTQAERRTQLERVVAQCNQPVL
LASPLLTGTCWQALAEQREASRRLGVEGMMLKARDGLYGVGRTKDMGVWWKWKVDPFSVD
AVLIYAQRGHGRRASLYSDYTFAVWDGPPGSDRTLVPFAKAYSGLTDEEMRKVDAIVRKT
TVEKFGPVSSVTPSMVFELGFEGIALSKRHKSGIAVRFPRMLRWRQDKKVEDADNLATLQ
DLLA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgccgagttgtacgcgaacctcgacgccaccacctcgagcaacgccaag
cttgccgcgttgcaagcctacttccgtcaagcagcacccgaggatgccgcctgggctgtg
tatttcctctccggaggacgcccccggcaattggtgcccacgcgcctgttaagggacatg
gccaccgaagcgtccggcatcgagccgtggctgtttgaagaaagctaccagtcggtaggc
gacctggcagagaccatctccctgctactaccggaatccccctacacctcggaggacggt
ctcgcggtgtggctggaggaaaaactcctgcctttgcgtggcttgcctccgctggaactg
gccgagcggctcccggcgttatgggcgcaattggatcaaccaagcctgatggtgtgcatc
aagctgatcaccggcagttttcgggtcggggtgtccaagttgctggtcacccgcgccctc
gccgcgatggccgacctcgacagcaagcgggtagcgcagcgattggtgggctacaccgac
ctgtccaatcgccctacgcctgagggctacctcaagctgatcgccgccgaatcgtccgac
gagcatgcgcaacggggcgggcagccttatccgttttttctcgcccatggcctggcacaa
ccggtggagcaattcgacgcgttgctcggtgcctcctccgactggcaggtggaatggaag
tgggatggcatccgtgcgcaactggtcaagcgtgaaggccgcctgtggatctggtcccgt
ggcgaagaattggtcaccgagcgtttccccgagcttcacagcctggtgagcggcctgccc
gatggcacggtgatcgacggcgaaatcgtggtgtggaaggatgcggtgcaacccttcgcc
ctgctgcagcagcggatcggccgcaagaccctgagcaaaaaggtgctggaggatgccccg
gtcgcggtgctcgcgtacgacctgttggaacacgagggcgacgactggcgcaaccacacc
caagccgagcgccgcacccaacttgagcgcgtcgtcgcccagtgcaaccaaccggttttg
ctcgcctccccgttgctgaccggaacatgttggcaagcgctggccgaacagcgcgaagcg
tcccgccgcctgggcgtggaaggcatgatgctcaaggcacgtgatggcctgtacggcgta
ggccgtaccaaagacatgggcgtgtggtggaaatggaaggtcgacccattcagcgtcgac
gcggtgttgatctatgcccagcgcggccacggccgtcgtgccagcctctacagcgactac
accttcgcggtgtgggacggcccgcccggcagcgatcgtacgctggtgccattcgccaag
gcctactccgggctgaccgacgaagaaatgcgcaaggtcgatgcgatcgtgcgcaagacc
acggtggaaaaattcggcccggtgagcagtgtgacgcccagcatggtgtttgaactgggg
ttcgagggcattgccctgtccaaacggcacaagagcgggattgcggtgcgatttccgcgg
atgttgcgctggcgccaggataagaaggtcgaggacgccgacaacctcgccaccctgcag
gacctgctggcctga

DBGET integrated database retrieval system