KEGG   Pseudomonas fluorescens L228: A7318_08230Help
Entry
A7318_08230       CDS       T04730                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
pfx  Pseudomonas fluorescens L228
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pfx02022]
    A7318_08230
Two-component system [BR:pfx02022]
 OmpR family
  Unclassified
   A7318_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AOE82345
LinkDB All DBs
Position
complement(1828529..1829293)
Genome map
AA seq 254 aa AA seqDB search
MHTPPVSMNDEQKGAVIADDKRWNTRALIVDDDVPIRELLIDYLARFGILATGVTDGTAM
RQAMQAETFDVVVLDLMLPGEDGLSLCRWLRAESDIPILMLTARCEPTDRIIGLELGADD
YMSKPFEPRELVARIQTILRRVRDDRTEQRANIRFDNWRLNSVLRQLVADDGLVVPLSNA
EFRLLWVFIERPRRVLSREQLLDAARGRSIEAFDRSIDLLVSRLRQKLGDDPKAPQLIKT
VRGEGYLFDARDIG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcatacccctcccgtctccatgaacgacgagcaaaaaggcgcggtgatcgccgatgac
aagcgttggaacacccgcgcgctgatcgtcgacgacgatgtgccgatccgcgaactgctg
atcgactacctcgcgcgcttcggcattctcgccacaggcgtcaccgacggcaccgccatg
cgccaggccatgcaggctgaaacctttgacgtggtggtgctcgacctgatgctgccgggc
gaggatggcctgtcgctgtgccgctggttgcgcgcggaatcggacatcccgatcctgatg
ctcaccgcccgctgcgaacccaccgaccgcatcattggcctggaactgggcgccgacgac
tatatgtccaagcccttcgaaccgcgtgaactggtcgcgcgtatccagaccatcctgcgc
cgcgtgcgcgatgaccgcaccgaacagcgcgccaatatccgcttcgacaactggcgcctc
aacagcgtgctgcgccaactggtggccgacgatggcctggtggtgccgctgtccaacgcg
gaattccgcttgctctgggtgtttatcgagcgcccgcgccgggtgttgagccgcgagcaa
ttgctggatgcggcacgtggccgctcgatcgaagcctttgatcgcagcattgacttgctg
gtctcgcgcctgcggcaaaaactcggggatgaccccaaggcaccgcaactgatcaagacc
gtacgcggtgaaggctacctgttcgacgcccgggatatcggctga

DBGET integrated database retrieval system