KEGG   Pseudomonas lurida: A7318_10055Help
Entry
A7318_10055       CDS       T04730                                 

Definition
(GenBank) gluconolaconase
  KO
K14274  xylono-1,5-lactonase [EC:3.1.1.110]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00040  Pentose and glucuronate interconversions
pfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A7318_10055
Enzymes [BR:pfx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.110  xylono-1,5-lactonase
     A7318_10055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Reg_prop
Motif
Other DBs
NCBI-ProteinID: AOE78915
LinkDB All DBs
Position
2211491..2212354
Genome map
AA seq 287 aa AA seqDB search
MSCIAVTPHRAQLGEGPFWDAPTQALYWVNIAGKQALRLMGGQLQVWQLPEHVSAFIPCE
SGDALVTLSSGVYRLDLVTEALTLLCVADPQAGNRGNEARCDAQGRLWLGTMQNNIGEQG
EDLPITRRSGGLFRIDADAQVTSLLSGLGIPNTLLWSDDGRQVHFGDSLDGTLYRHAIQP
GGQLDPAQTWFGPHERGGPDGSAMDVEGYIWNARWDGSCLLRLTPEGEVDRIVELPVSRP
TSCVFGGPNLTTLYITSAASPLDHPLDGAVLAMEVDVAGKPCHRFAG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtatcgccgttaccccgcaccgtgcgcagttgggcgaaggtccgttctgggat
gcgcccacccaggcgctgtactgggtgaatatcgccggcaagcaggcgctgcgcctgatg
ggcgggcagttgcaggtgtggcagttgccggagcatgtctcggcgttcatcccgtgtgaa
agcggcgatgccttggtgaccttgagcagtggcgtgtatcgcctcgacctggtcaccgag
gccttgaccctgctgtgcgtggccgacccgcaagcaggcaaccgtggcaacgaagcacgc
tgcgatgcccagggccgcctgtggctgggcacgatgcagaacaacattggtgagcagggt
gaagacctgcccattacccgacgttccggcggcctgtttcgcatcgatgccgatgcgcag
gtcacgtcgttgctcagcggcctgggcattcccaacaccttgctgtggagtgatgacggc
cgccaggtgcatttcggcgacagcctggacggtacgctgtaccggcatgctatccagcca
ggcggccagctcgaccccgcgcaaacgtggttcggcccacacgagcgtggcgggccggac
ggctccgccatggacgttgaaggctatatctggaacgcccgctgggacggcagttgcctg
ttgcgcctgacacccgagggcgaggtggaccgtatcgtcgaactgcccgtcagccgcccc
accagttgtgtgtttggtggcccgaacctcaccaccctgtacatcaccagtgctgccagc
cccttggatcaccccttggatggcgcggtactggcgatggaagtcgatgtcgcggggaaa
ccctgtcatcgcttcgccggctaa

DBGET integrated database retrieval system