KEGG   Pseudomonas lurida: A7318_13130Help
Entry
A7318_13130       CDS       T04730                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfx  Pseudomonas lurida
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7318_13130
Enzymes [BR:pfx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A7318_13130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 Thi4 NAD_binding_8 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AOE79504
UniProt: A0A5E6PEH3
LinkDB All DBs
Position
2923045..2924610
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVVSLTTLITLKTDGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKDAFDVLVVGGGPAGSAAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLIPAKNAGD
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTLDLEGIFVQIGLLPNTDWLKGTVELTPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggtgcgaaatcccaggaaatgcttgccctcttg
caggatgttgtcagcctcaccacgctgattaccctgaaaaccgatggtgatgatgcgcgt
aagccttcgttctccatcaaccgcccgggtgccgatatcagcctgcgttttgccggcatc
cccatgggccatgaattcacttcgttggtgctggccctgctgcaagtcggtggccacccg
tcgaaggccagtgtcgaagtgattgaacagatccgcgccctcaaaggcgagttcagcttc
gagacctacttctcgctgtcttgccagaactgcccggacgtggtccaggcgctgaacctg
atggctgtgctcaaccccaacatccgccacgtcgccatcgacggcgcgctgttccaggct
gaagtcgacgaacgccagatcatggcggtgccaagcgtgtacctcaatggtgtgaacttc
ggccagggccgcatgggcctggaagaaatcctcgcgaagctcgacaccagcggtatcgaa
aaagccgccgagaaaatcagcgccaaagacgcctttgatgtcctcgtcgtcggcggtggc
ccagccggttcggcggcagcgatctacgccgcacgcaaaggtatccgcaccggcgtcgct
gccgagcggttcggcgggcaggtgctggacaccatgtccatcgagaactttatctcggta
caggaaaccgaaggcccgaaactggccagcgccctggaagcccacgtacgccagtacgac
gtggacatcatgaacctgcagcgcgccagtagcttgatcccggcgaaaaacgccggtgac
ctgcacgaaattcgttttgagagcggtgcgaccctcaagtccaagaccgtgatcctggcc
accggtgcccgctggagagaaatgggtgtaccgggcgagcaggaatacaaggccaagggt
gtttgcttctgcccgcactgcgacggtccgctgttcaaaggcaagcgtgtcgcggtgatc
ggcggcggtaactccggcgtcgaagccgccatcgacctggccggtatcgtcagccacgtg
accctgctcgagttcgacagcaagctgcgcgccgacgctgttttgcagcgcaagctctac
agcctgcctaacgtcgacgtgatcaccagtgcgctgaccagtgaagtgaaaggcgatggc
cagaaagtcaccggcctggcgtacaaggatcgcgacagcggcgagttcaagaccctcgat
ctggaagggatctttgtacagatcggtttgctgccaaacaccgactggctcaaaggcacc
gtagagctgacaccgcgcggcgagatcatcgtcgatgcccgtggcgagacgtcactgccc
ggcgtatttgctgccggtgacgtcacgacggtgccgtacaagcagatcgtgatcgcggtg
ggtgagggtgccaaggcttccttgagtgctttcgatcacctgatccgtacctctgcgcct
gcataa

DBGET integrated database retrieval system