KEGG   Pseudomonas lurida: A7318_16490Help
Entry
A7318_16490       CDS       T04730                                 

Definition
(GenBank) gluconolactonase
Organism
pfx  Pseudomonas lurida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Phytase-like
Motif
Other DBs
NCBI-ProteinID: AOE80132
LinkDB All DBs
Position
complement(3673212..3674105)
Genome map
AA seq 297 aa AA seqDB search
MNAELIVDARNAVGECPVWVPEENALYWVDIPNGGLQRWSAASGHIAAWKAPQMLACIAR
TTAGNWVAGMESGFFQLTPHNDGSLDTTPLASVEHPRADMRLNDGRCDRQGRFWAGSMVL
DMGLNAAEGILYRYAAGAAPCAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQVWAFDYD
IDTGTPSNRRVFVDMHQHLGRPDGAAVDADGCYWICANDAGLVHRFTPDGRLDRSLVVPV
KKPTMCAFGGSRLETLFVTSIRDDQSEQSLSGGVFALNPGVQGLPEPTFALQVHGKC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaactgattgttgacgcgcgtaatgccgtgggcgaatgcccggtatgggtc
cccgaggaaaacgcgctgtattgggtggatatccctaacggtgggctgcaacgctggagc
gccgccagcggccatatcgccgcctggaaagccccacagatgctcgcgtgtatcgcccgc
accacggcgggtaactgggtcgccggcatggaaagcggttttttccagctcacaccgcac
aacgacggcagcctcgacaccacgcccctggcgagtgtcgagcacccgcgcgcggacatg
cgcctgaatgacggccgctgtgatcgccagggccgcttctgggccggcagcatggtgttg
gacatgggcctgaacgcagccgagggtatcctctaccgctacgcggccggcgcagcacct
tgtgcgcaacttgacggttttatcaccctcaatggcctggcgttcagcccggatggccgc
acgatgtatgcctccgattcccacccgctggtgcagcaggtctgggctttcgactacgac
atcgacactggcacgccctcaaatcgccgcgtgttcgtggacatgcaccagcacctcggc
cgccccgacggtgccgccgtcgatgccgacggctgctactggatctgcgccaacgacgcc
gggctggtccaccgtttcacgcccgacggccgcctggatcgctccctggtggtcccggtg
aagaagcccaccatgtgcgcctttggcggcagtcgcctggagacattgttcgtcacttcc
atccgcgatgatcagagcgaacagtcgctgtccggcggcgtgttcgccctcaaccccggc
gtgcaagggttgcccgaacccaccttcgcgctccaggtgcatggcaaatgctga

DBGET integrated database retrieval system