KEGG   Pseudomonas fluorescens L228: A7318_17025Help
Entry
A7318_17025       CDS       T04730                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pfx  Pseudomonas fluorescens L228
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7318_17025
Enzymes [BR:pfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     A7318_17025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AOE80228
UniProt: A0A2S8XE22
LinkDB All DBs
Position
complement(3793332..3794417)
Genome map
AA seq 361 aa AA seqDB search
MDKHTEMQAVVCHGPKDYRLERIGKPQARANELVIRIAACGICASDCKCHSGAAMFWGGD
NPWVKAPVVPGHEFFGYVVEAGEGAEAHFEVAVGDKVIAEQIVPCGKCRFCKSGKYWMCE
VHNIFGFQREVAEGGMAQYMRIPKTAIVHKIPESVSLEDSALVEPMACSIHTVNRGDIQL
DDVVVIAGAGTLGLCMVQVAALKTPKKLVVIDMVDERLALAKQFGADVVINPSRDNAREI
INGLTDNYGCDVYIETTGVPAGVTQGLDLIRKLGRFVEFSVFGAETSVDWSIIGDRKELD
VRGAHLGPYCYPIAIDLFERGLVTSKGIVTHDFALDDWAEAFELANSTKSIKVLLKPATL
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcacaccgaaatgcaagccgtcgtttgccacggccccaaagactatcgcctg
gaacgcatcggcaaaccccaggcgcgtgccaatgaactggtgatccgcatcgccgcctgt
ggcatctgcgccagtgactgcaagtgccactccggcgcggcgatgttctggggcggtgac
aacccttgggtcaaggcgccggtggtgccggggcacgagttttttggctatgtggtggaa
gcgggcgagggcgccgaggcgcatttcgaagtcgcggtaggcgacaaggtgatcgccgag
cagatcgtgccctgtggcaagtgccgcttctgcaagtcgggcaagtattggatgtgcgaa
gtgcacaatatcttcggcttccagcgtgaagtggctgaaggtggcatggcccagtacatg
cgcatccccaagaccgccatcgtgcacaagattcccgagtcggtgtcgctggaagactcg
gcgctggtggagccgatggcgtgttcgatccataccgtcaaccgtggcgatatccagctc
gatgacgtggtagtgatcgccggcgccggcacgcttggcctttgcatggtccaggtcgcc
gcgttgaagacgccgaagaagctggtggtgatcgacatggtcgacgagcgcctggcgctg
gccaagcaatttggcgccgatgtggtgatcaacccgtcgcgcgacaacgcccgtgaaatc
atcaacggcctcaccgacaactacggctgcgacgtctacatcgaaaccaccggtgtaccg
gcgggcgtgacccaggggttggacctgatccgcaagcttgggcgttttgtcgagttcagc
gtgtttggtgccgagaccagcgtcgactggtcgatcatcggcgaccgcaaggagctggac
gttcgcggcgcgcacctcggcccgtattgctacccgatcgccatcgacctgttcgagcgt
ggcctggtcacgtccaaaggcatcgtcacccatgacttcgcgttggacgattgggccgag
gcttttgaactcgctaactcgaccaagtcgatcaaggtgctgttgaagccggctaccctt
ccatga

DBGET integrated database retrieval system