KEGG   Pseudomonas fluorescens L228: A7318_18455Help
Entry
A7318_18455       CDS       T04730                                 

Definition
(GenBank) hypothetical protein
Organism
pfx  Pseudomonas fluorescens L228
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AOE80481
UniProt: A0A2S8XF39
LinkDB All DBs
Position
4089590..4090396
Genome map
AA seq 268 aa AA seqDB search
MTTTEATPESTAETPAEKTEAVDAAPLPWADVQAEHFKMLRLAPLATDRATGVRPLRFVQ
FGYAERNDKHHSLLRMVIQLPGQRVRREQNHLDIWVDHDKHRVHFGPGNSLEIEPANRGI
GRFLVAQGAAWAKKKWSHYRVDGVDLANKDALNEATRLRRDHFLRIQGFDVAYADVQHLK
GNVQPGKVSDVLDSWNTEKVQFVEILEAAQMLQQAEQNLAEQEVKLRKEEEKVTKFKRED
SGLRFTITCLVAFTVFQAGLLIWIATHR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccactgaagcaacaccggaatccaccgccgaaaccccggctgaaaaaaccgag
gccgtcgacgcggcgcccctgccgtgggcggatgtccaggccgagcatttcaagatgctg
cgcctggcgccactggccaccgaccgcgccaccggcgtgcggccgttgcgcttcgtgcag
ttcggctatgccgagcgcaatgacaaacatcacagcctgttgcgcatggtcatccaactg
ccaggacagcgggttcgccgcgaacagaatcatctggatatctgggtcgaccacgacaag
caccgcgtgcacttcggccccggcaacagcctggaaatcgaaccggccaaccgcggtatc
gggcgcttcctggtagcccaaggcgccgcgtgggcgaagaagaagtggtcacactaccgg
gtcgacggcgtcgacctggccaacaaagatgcgttgaacgaggccacccgcctgcgccgc
gatcatttcctgcgtatccagggttttgatgtggcctatgccgacgtgcagcacctgaag
ggcaacgtgcagccgggcaaggtcagcgatgtgctggacagctggaacaccgagaaagtg
cagttcgtggagattctcgaagcggcgcagatgctgcaacaagccgaacagaacctggcg
gagcaggaagtgaagctgcgcaaggaagaggaaaaggtcaccaagttcaagcgtgaagac
agcgggttgcgttttaccatcacgtgcctggtggcgttcacggtgtttcaggcggggttg
ctgatctggattgccacccaccggtaa

DBGET integrated database retrieval system