KEGG   Pseudomonas fluorescens L228: A7318_18660Help
Entry
A7318_18660       CDS       T04730                                 

Definition
(GenBank) non-ribosomal peptide synthase/polyketide synthase
Organism
pfx  Pseudomonas fluorescens L228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AOE80521
LinkDB All DBs
Position
complement(4133934..4146815)
Genome map
AA seq 4293 aa AA seqDB search
MMDAFELPRTLVQSLQCRAAQTPDQVALRFLGESAEHSVVLSYRDLDQRARTIAAALQAN
AELGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLLSIISDAEPRLL
LTIASLADGLSEIENAPPVLSVDGLENAGNWVAPDLHPDDIAFLQYTSGSTALPKGVQVS
HGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAYFL
GRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSKWRVAYSGSEPIRLDTL
ERFAEKFAACGFTPNNFFASYGLAEATLFVAGGTRGHGIPALRVDEQALAANRAEPGQGS
AIMSCGTSQPEHAVLIADPDTLTELADNSVGELWASGPSIAHGYWRNPEATAKTFVQQAG
RTWLRTGDLGFIRDGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAFAV
NDQGLEGIGIAAEISRSVQKILPPEALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTSSG
KVQRAACALRHADGSLDSYAQFPDLQAKASDGGLQSELQQQIAAIWCEQLQVATVAADDH
FFLLGGNSITATQVVARLRETLGLELNLRLLFEAPTLQGFAANVAQLQQDGGVAQGAIHS
LSRQDELPQSLAQNRLWITWQLDPHSSAYTIPGALRLRGELDEDAVRASFQQMIQRHEAL
RTRFYERDGQAFQRIEAKTDFELQVIDLSDVPAGEREARAQQIREDEARTQFDLEKGPLL
WVTLVRLDDEDHQLLVTLHHIIADGWSLNILIDEFSRLYAAAAQGQALELPPLALQYADY
GTWQRQWLAEGESQRQLAYWKAQLGEDPPALGLATDHPRSAHHRHTASRHTVRLGVSLSE
AVRQTAQANESTPFMLLLAAFQSLLYRYSGQRDIRIGVPSANRPRQETQGLVGFFINTLV
LRAELDGRLPFNQLLAATRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQRDL
SALRRLPGLLADELPWHSREAKFDLQLHTEEDRNGRLSLSFDYADELFDTATIERLAEHY
ITLLQAVCEQPQQALGDLKLMHKDEQQPWSEAPCAPARQWLPELLNQQASDSTALVWDGG
SLTYAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGGAYVPLDPDY
PAERLAYMLKDSGVHLLLTQTALLEQVPSAEGVCVIAMDSLHLDSWPTQPPGLHLHGDNL
AYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYQLNGTDVLLQKAPISFDVSVWECFWP
LITGCRLVLAGPGEHRDPHRIAQLVQEHGVTTLHFVPPLLQLFIDEPLAAECTSLRRVFS
GGEALPAELRNRVLAQLPTAQLHNRYGPTETAINVTHWHCRVEDGERSPIGRPLGNVICR
VLDEQLNPVPVGVPGELCIGGIGLARGYLGRAGLTAERFVADHQGARLYRTGDRARWNAD
GVIEYLGRLDQQVKLRGFRVEPEEIEARMLALEGIAQAVVRVRDAQLIGYYTAHSELDEQ
QVKTALAAELPEYMVPALLMRLDAMPLSPSGKLDRRALPEPVWHVREHVEPETPLQQQVA
AIWREVLGLPSIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRTLFEASELGAFVEQ
VGLIQASGQRNQQTAIAKVDRSQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARLRGVLD
VGRFEAALQALVMRHETLRTTFPSVDGVACQKVSPQTGLRMDWQDFSALDETERQQRLQQ
LADHEAHTPFNLETGPLLRACLVKAAEREHYLVLTLHHIVTEGWAMDIFARELSALYEAF
IDERLSPLAPLPVQYLDYSVWQRQWLEAGERQRQLDYWTAQLGSDHPLLELPGDRPRPPV
QSHRGELYRFDLSDDLAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIGAPVAN
RIRPESEGLIGAFLNTQVLRCQLNGQMSVAELFEQVRHIVIEGQSHQDLPFDHLVEALQP
PRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVEYLANDARATKFDLNLEVTDLDHRLGCC
LTYSTDLFDEPRIARMAGHWRNLLEALIASPEQRLSELPLLTATEQRALQDSLGIEAGEH
RLDQCIHAMFSQQARARGDAPALTFAGETLSYRELDARANRLAWMLRERGVGPQVRVGLA
LPRSLEMVVGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFEALGELPA
SVACWCLEDDSPVLANYPSGELPFISLAQHQAYLIYTSGSTGKPKGVVVSHGEIAMHCAA
VIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDAEEICALIRTHRI
NILGFTPSYGSQLAQWLATQQQTLPVRMCITGGEALTGEHLQRIRAAFQPQVFFNAYGPT
ETVVMPLASLAPEQLEEGAASVPIGSIIGDRVAYILDADLALVPQGATGELYVGGAGLAQ
GYHQRPGMTAERFVADPFSRNGARLYRTGDLVRQRADGLVEYLGRIDHQVKIRGFRIELG
EIETRLLEHEAVREAVVLALDSPSGKQLVAYLVSDAEHGAVRDALKAHLKAQLPDYMVPA
HFIVLDSMPLTANGKLDRRALPQPDPQANRQQYVAPRNELESTLAAIWCAVLNVQQVGLD
DNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATRAEQVTAEQGVLTG
RSGLTPIQHWFFDTEIPQRQHWNQALVLKPLQLLDPHRLERALLAVLEHHDALRLSFSQR
DAHWYAEHLAVPQGGVLMQAQVRDMAQCTALFTDTQRSLDLEHGPLLRALLVDGPEGQQR
LLIAIHHLVVDGVSWRVLLEDLQAVYRQLSDGQSVSLPAKTSALRDWAARLQAYAGSESL
REELSLWQAQLAGPDVALPVARPQGSLRNRDADTVSVRLDAEQTRQLLQQAPSAYRTQVN
DLLLTALARVVCRWSGHASALIQLEGHGREALFDDIDLTRSIGWFTSAYPLRLTPQAALG
DSIKAIKEQLRGVPHKGLGYGVLRYLADSPCKQSMAALPSAQITFNYLGQFDQSFGADAL
FHPLDESAGLAHDPDAPLPNELSVDSQVYGGELVLRWTFSRERFDQPTVRELAEAYLAEL
QSLTQHCLQDDAGGLTPSDFPLAQLSQSQLDSLPVPASAIEDVYPLTPMQEGLLLHTLLE
PGTGLYYMQDRYRINSALDPVRFAQAWQAVIARHEALRASFCWNVGEDMLQVIHKPGSTP
IEYLDWSQEPEGEHEPRLQALLKQEREAGFDLLNQAPFHLRLIRVGAERYWFMMSNHHIL
IDAWCRSLLMNDFFEIYMALGEGREAQLAMPPRYRDYIAWLQRQNLNEARQWWQQNLQGF
ERTTPIPSDRPFLREHAGHSGGMVVGDCYTRLDARDGAQLRELAQAHQLTVNTFAQAAWA
LVLRRLSGDRDVLFGVTVAGRPVEMPEMQRTVGLFINSIALRVKLPEDDQRCSVRQWLSG
LLDSNMQLREYEYLPLVTLQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAHSLNATSDS
GRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDETTVQGMLGEFKRLLLALVQGFHGDMADL
PLIGEQEREFLVQGCNQSEHDYPLERSYVELFEAQVAAHPQRIAASCLDQQWTYDELNRR
SNGLGHALIAAGVGLDQPVALLAERGLDLFGMIIGSFKAGAGYLPLDPGLPSQRLRSIID
LSRTPLLVCTEACREQAIELLEGFDCQLLVWEEVPARGENPGIYSGPDNLAYVIYTSGST
GLPKGVMVEQRGMLNNQLSKVPYLALDDADVIAQTASQSFDISVWQFLAAPLFGARVDIV
PNTLAHDPQGLLEHVQAQGITVLESVPSLIQGMLAQDRIGLDGLRWMLPTGEAMPPELAH
QWLLRYPQVGLVNAYGPAECSDDVAFYRVDLASTRGTYLPIGTPTDNNRLYLLDGALELV
PQGAVGELCVAGTGVGRGYVSDPLRTAPVFVPNPFGALGERLYRTGDLARRRSDGVLEYV
GRIDHQVKIRGYRIELGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVVADGTLNPGE
RLDRIKQRLRAELPEYMVPLHWLWLDRLPLNANGKLDRKALPALEIGQLHSQDYLAPRNE
LETTLAAIWAEVLKVDRVGVQDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMFECSTV
AELAEYIEGLAANEISAEKVDRLSDLMAELEGL
NT seq 12882 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttccccgcaccctggtccagtcccttcagtgtcgcgctgcg
cagaccccggaccaggtcgccctgcgcttcctcggcgagtccgccgagcacagcgtcgta
ctcagttaccgcgacctggaccagcgcgcccgcaccattgccgctgccctgcaagccaat
gcggaactgggcgaccgtgcggtgctgttgttccccagtggcccggattacgtcgcggcg
ttctttggttgcctgtacgccggggtcattgcggtgccggcctatccgccggagtccacc
cgtcgtcatcaccaggagcgcctgctgtcgatcatcagcgatgccgagccgcggctgttg
ctgaccatcgccagcctcgccgacggcttgtcggagatcgaaaacgcgccgccggtattg
agcgtcgatggcctggagaacgcgggtaactgggttgcccccgacctgcaccccgacgac
atcgccttcctgcaatacacctccggttccaccgcgctgcccaagggcgtacaagtcagt
cacggcaacctggtggccaacgaagtgctgatccgtcgcggctttggcatcgacctcaac
ccggacgacgtgatcgtcagctggctgccgctgtaccacgacatgggcctgatcggcggc
ctgctgcaaccgatcttcagtggcgtgccctgtgtgttgatgtcgccagcctacttcctc
ggccggccgttgcgctggctcgaagcgatcagcgaatacggcggcaccatcagcggtggc
ccggatttcgcctatcgcctgtgcagcgagcgggtcagcgagtcggccctggaacgcctg
gacctgagcaagtggcgcgtggcctattccggttccgaacctatccgcctcgacaccctg
gaacgcttcgccgagaagttcgccgcgtgcggttttaccccgaacaatttcttcgcctcc
tacggcctggcggaggcgaccttgtttgtcgccggcggtacccgtggccatggcatcccc
gcgttgcgcgtcgacgagcaggcgctggccgccaatcgcgccgagccggggcagggcagt
gcaatcatgagttgcggcaccagccagcccgagcatgcggtgctgatcgccgacccggac
accctcactgagctggccgataacagcgtcggcgaactctgggccagtggtccgagcatc
gcccacggctactggcgcaaccccgaagccaccgccaaaaccttcgtgcaacaggccggc
cgtacctggctgcgcaccggcgacctgggttttatccgtgacggcgaggtgtacatcacc
ggtcgcctcaaagacttgctgatcgtgcgcggccacaacctgtatccccaggacatcgag
caaaccatcgaacgcgaagtggaggtggtgcgcaaaggccgggtcgccgcatttgcggta
aatgaccagggcctggaaggcatcggcattgccgccgaaatcagccgcagcgtgcagaaa
attctgccgcccgaagcgctgatcaaggcgatccgccaagccgttgccgaggcttatcaa
gaggcgccaagcgtggtggtgttgctcaatcccggtgcattgcccaagacttccagcggt
aaggtgcaacgtgccgcgtgtgcgcttcgccatgcggatggcagcctcgacagctatgcg
cagttccccgatctgcaggcaaaggcgagcgatggtgggctgcagtccgagctgcaacag
cagatcgccgcgatctggtgcgagcaactgcaggtggcaacagtggccgccgacgatcac
ttcttcctgctcggcggtaactccatcaccgctacccaggtcgtggcgcgcctgcgtgaa
accctcggcctggaactgaacctgcgtctgctgttcgaggcgccgaccctgcaaggcttt
gcagcgaatgtcgcgcagttgcaacaggacggcggcgtggcccaaggcgcgatccacagc
ctatcacgccaggacgaactgccccagtccctggcgcagaaccgcctgtggatcacctgg
caactggacccgcacagcagcgcctacaccatccccggtgccctgcgcctgcgcggcgag
ctggatgaagacgccgtgcgcgcaagcttccagcaaatgatccagcgccacgaagccctg
cgcacccgcttctatgaaagagacggccaggccttccagcgtatcgaggccaagaccgat
tttgagctgcaagtcatcgacctcagtgacgtgcccgctggcgagcgcgaagcccgtgcg
cagcagatccgtgaggatgaagctcgcacccagttcgacctggaaaagggcccgctgctg
tgggtgaccctggtgcgcctggatgatgaggaccaccagttgctggtgacgctgcatcac
attatcgccgatggctggtcgctcaatattctcatcgacgagttctcacgcctctacgcc
gccgctgcccagggccaagccctggagctgccgccgctggccctgcaatacgccgactac
ggcacgtggcaacgccaatggctggccgagggtgaaagccagcggcaactggcgtactgg
aaagcgcagttgggtgaagaccctcccgccctgggcctggccaccgaccacccacgctcg
gcacaccatcgacacacggcctcgcgtcataccgtgcgcctcggcgtcagcctcagcgaa
gcggttcgccagaccgcccaggccaatgagtcgacccccttcatgctgttgctggcggcg
ttccagagcctgctctaccgctacagcggtcagcgcgatattcgcatcggcgtacccagc
gccaaccgtccacgccaggaaacccaaggcctggtcggcttcttcatcaacaccctggtg
ctgcgggccgagctggacgggcgcctgccgttcaaccagttgctggccgcgacacgccag
gctgcactgggcgcccaggcccatcaggacttgcccttcgaacaactgctggaagctttt
ccgcaagcccgtgaacaggggcttttccaggtcatgttcaaccaccagcaacgtgatctg
agcgcgttgcgccgcctgccaggcctgctcgccgatgagttgccatggcacagccgcgaa
gccaagttcgacctgcaactgcacaccgaagaggaccgcaacgggcgcctgagcctgtcg
ttcgactacgccgacgaactgttcgacaccgcgaccatcgagcgcctggccgagcactac
atcaccctgttgcaggcggtgtgtgaacaaccgcagcaagccctcggcgacctcaagctg
atgcacaaggatgagcagcagccgtggagcgaagccccgtgcgcgccggcccggcagtgg
ctgcccgaactgctcaaccagcaggcctcggacagcaccgccctggtctgggacggcggc
agcctgacgtacgcccaactgcacacccaggccaaccgcctggcccactacctgcgcgat
aaaggcgtcggcccagatgtgtgcgtggccatcgccgccgagcgttcgccgcaactgctg
atcggcctgctggcgatcatcaaggccggtggcgcgtatgtgccgctcgacccggattac
cccgccgagcgcctggcctacatgctcaaggacagtggtgtgcacttgttgctgacccag
accgcgttgctggaacaggtgccgagcgccgaaggcgtgtgcgtgatagcgatggacagc
ctgcacctcgacagttggcccacccagccgcctggcctgcacctgcacggcgataacctt
gcctacgtgatctacacctccggttccaccggccagcccaagggcgtgggtaatacgcat
gcggcattggccgagcgcttgcaatggatgcaggccacctaccaactcaacggcaccgac
gtgctgctgcaaaaggcgccgatcagtttcgacgtgtcggtgtgggaatgcttctggccc
ctgatcaccggttgccgcctggtgctggctggccccggtgagcaccgcgacccgcatcgc
atcgcgcagctggtacaagaacacggcgtgaccacgctgcactttgtgccgccgctgttg
cagctgtttatcgatgagccattggcggccgaatgcaccagcctgcgccgcgtgttctcc
ggcggcgaagccttgcccgccgaactgcgcaaccgcgtgttggcgcagttgccgacggcg
caattgcacaaccgttatggcccgaccgaaaccgcgatcaacgtgacccactggcactgc
cgcgtggaagacggcgagcgctcgccgattggtcgccccttgggcaatgtgatctgtcgc
gtgctggacgaacagctcaaccccgtgcccgtcggcgtgccgggcgaactgtgcatcggt
ggtatcggcctggcccggggttacctcggccgcgccgggttgacggctgagcgttttgtc
gccgaccaccagggggcgcgcctgtatcgcaccggtgaccgcgctcggtggaacgccgac
ggtgtgatcgagtacctcgggcgcctcgaccagcaggtcaagctgcgtggctttcgcgtc
gagccggaagaaatcgaagcacgcatgctcgccctggaaggcatcgcccaggccgttgtg
cgggtgcgtgatgcacagttgatcggctattacaccgcccattccgagctggacgaacag
caggtcaagaccgcactggcagccgagctgccggaatacatggtgcctgcgctgttgatg
cgcctggacgccatgcccctgagccccagcggcaagctggaccgccgtgcgctgccggag
ccggtgtggcacgtgcgcgaacatgtcgagcccgaaaccccgctgcaacaacaggttgcg
gcgatctggcgcgaagtccttggtttgccaagcattggcctgcgcgatgactttttcgcc
ctcggcggccactcgttgctggctacgcaaatcatctcccgtacccgccaggcctgcgat
gtcgagctgccgttgcgcaccctgttcgaagccagcgagttgggcgcgttcgtcgagcag
gtcggactgatccaggcatcgggccaacgcaaccaacaaaccgccatcgccaaggtcgat
cgcagccagccggtgcccttgtcctattcccagcagcgcatgtggttcctgtggcagatg
gagccggacagcccggcctacaacgtcggcggcatggcgcgcctgcggggtgtgctggat
gtggggcgcttcgaggcggcgttgcaggccttggtcatgcgtcacgaaaccctgcgcacc
accttcccgagtgtcgacggcgtggcttgccagaaggtttcgccgcagaccgggctgcgc
atggactggcaggacttctccgcgctggacgaaaccgaacgccagcaacgcttgcaacaa
ctggctgatcacgaggcccatacaccgttcaacctggagaccgggccgttgctgcgtgcc
tgcctggtcaaggccgccgagcgcgaacactacctggtgctgaccctgcaccacatcgtc
accgaaggctgggccatggacatctttgcccgtgaactcagcgcgttgtacgaggccttt
atcgacgagcgcctgtcgccgttggcaccgttgccggtgcaatacctcgactacagcgtg
tggcagcgccaatggctggaggccggcgaacgccagcgtcaactggactactggaccgcg
caactgggcagcgaccaccccttgctggaactgcccggcgaccgtccacgcccgccggtg
caaagccaccgtggcgagctctaccgcttcgacctgagtgacgatctggcggcgcgcgtg
cgtgcctttaatgccgagcgtggcctgaccctgttcatgaccatgaccgcgaccctggcc
gtattgctctaccgctacagcggccagaccgacctgcgcattggcgcgcccgtggccaac
cgcatccgtccggaaagcgaagggctgatcggcgccttcctcaacacccaggtactgcgt
tgccagctcaatggacagatgagcgtcgctgagttgttcgagcaggtgcgccacatcgtg
atcgaaggccagtcccatcaggacctgccgttcgaccacctggtggaggccctgcagccg
ccgcgcagtgcggcgtacaacccgctgttccaagtgatgtgcaacgtgcagcgctgggaa
ttccagcagagccgccaactggccggcatgaccgtcgaatacctggccaatgatgcgcgt
gcgaccaaattcgacctcaacctggaagtcaccgacctcgatcatcgcctgggttgctgc
ctgacctacagcaccgacctgttcgacgagccgcgcattgcgcgcatggccggacactgg
cgcaacctgctggaagccttgatcgcttcccccgagcagcgcctcagcgaattgccgtta
ctgaccgccaccgagcagcgtgcgttgcaggacagcctgggcatcgaggcgggcgagcat
cgccttgatcaatgcatccatgcaatgttcagccagcaagcgagagcccgtggcgatgcg
cccgcgctgaccttcgcgggtgaaacgctgagctaccgcgagctggatgcccgcgccaac
cgcctggcctggatgctgcgcgagcgtggcgtcggcccgcaggtgcgagtgggcctggcg
ctgccgcgctcgctggaaatggtggttggcctgctggcgattctcaaggccgggggcgcc
tatgtgccgctcgacccggaatacccgttggaccgcctgcactacatgatcgaagacagc
ggcatcggcctgttgctcagcgatgcggcgatgttcgaagccctcggcgagttgcccgcg
agcgtggcgtgctggtgcctcgaagatgactcgccggtgctcgccaactacccgtccggc
gagctgccgtttatcagcctggcgcaacaccaggcgtacttgatctacacctccggttcc
accggcaagcccaaaggcgtggtggtgtcccacggtgaaatcgccatgcattgcgcggcg
gtgatcgagcggtttggcatgcgcccagacgactgcgaactgcacttctattcgatcaac
ttcgacgccgccaccgagcgtttgctggtgccgctgctcagtggcgcgcaggtggtgctg
cgtgcccagggccagtgggacgcagaagaaatctgcgcgctgatccggacccatcgcatc
aatattctgggcttcacgccgagctacggcagccaattggcgcaatggctggcgacccag
cagcagaccttgccggtgcgcatgtgcatcaccggtggtgaagcgctcaccggcgaacac
ctgcagcgcatccgcgccgcgttccagccgcaggtgtttttcaacgcctatggcccaact
gaaacagtggtgatgccgctggccagcctcgcgcccgagcagttggaagagggcgctgcg
agcgtaccgatcggcagcataatcggtgaccgcgtggcctatattctcgatgccgacctg
gcgttggtgccgcagggggcgaccggcgagctgtacgtcggtggcgccggcctggcccag
gggtatcaccagcgcccggggatgaccgccgagcgttttgtcgccgacccattttcgcgc
aatggcgcacgcctgtaccgtaccggcgacctggtgcgccaacgcgccgatggcctggtt
gagtacctggggcgtatcgaccatcaggtgaagattcgcggtttccgcattgaactgggc
gagatcgaaacccgcctgctggagcacgaagccgtgcgcgaagcggtggtgctggcgctg
gattcgccgagtggcaaacagctggtggcgtacctggtcagtgatgccgagcacggcgca
gtacgcgatgcgctcaaggcgcacctcaaggcgcaactgccggactacatggtgcccgcg
cacttcatcgtgctcgacagcatgccgctgacggccaacggcaaacttgaccgtcgtgcc
ttgccgcagccggatccgcaagccaaccgccaacagtacgtcgccccgcgcaatgagctt
gaaagcacgttggccgccatctggtgcgccgtgttgaacgtgcagcaggtgggcctggac
gataacttctttgaactgggcggcgactcgatcctgtcgatccaagtggtcagccgtgcg
cggcaggccgggattcatttcagcccgcgcgacctgttccagcaccagaccgtgcaaacc
ctggcagcggtcgccacgcgcgccgagcaggtcacggccgagcagggcgtactgaccggc
cgctctggcctcacgccgatccagcactggttcttcgataccgagattccacagcgccag
cactggaaccaggcgctggtcctcaagccgctgcaactgctggacccccatcgcctggag
cgagcgttgctggcagtgctggagcatcacgatgccctgcgcctgagcttctcccagcgc
gacgcgcactggtatgccgaacacctggctgtgccgcagggcggcgtgctgatgcaggcg
caagtgcgcgatatggcgcagtgcaccgcgctgttcaccgacacccagcgcagccttgac
ctggaacacggcccgctgctgcgcgccttgttggtggacggtcccgaggggcagcagcgc
ctgttgatcgcgatccatcacctggtggtggacggcgtgtcgtggcgcgtattgcttgaa
gatctccaagccgtttatcgccaactgagcgacggccagtccgtcagcctgccggccaag
accagcgccctgcgtgattgggccgcgcgtttgcaggcctacgccggcagcgaatcgtta
cgtgaagaattgagcctctggcaggcccagttggcgggccctgatgtggctttgccggtg
gcccgcccgcaaggttcgctgcgcaaccgcgatgccgataccgtcagcgtgcgcctggat
gccgagcagactcgccagttgttgcaacaggccccgagcgcctaccgcacccaggtcaac
gacttgctgttgaccgccttggcccgtgtggtgtgccgctggagcggccacgcttcggcg
ctgatccagctggaaggtcatggccgcgaagccctgttcgatgacatcgacctgacccgc
agcatcggctggttcaccagtgcttatccgctgcgcctcaccccgcaagcggccctgggc
gactcgatcaaggcgatcaaggaacaactgcgcggcgtgccgcataaaggcttggggtat
ggcgtgctgcgctacctggccgacagcccgtgcaaacagagcatggccgcactgccgagc
gcgcagatcactttcaactacttgggccagttcgaccagagcttcggcgccgatgcgctg
ttccatccactggacgagtctgcaggcctggcccatgacccggatgcgccgctgcccaac
gagttgagcgtcgacagccaggtgtatggcggcgagttggtgctgcgctggaccttcagc
cgcgagcgcttcgatcagccgaccgtgcgcgaattggccgaggcgtatctggccgaactg
caaagcttgacccagcactgccttcaggacgatgccggtggccttacaccgtccgacttc
ccgctggcccagttgtcccagtcgcaactcgacagcttgccagtaccggccagtgctatc
gaagacgtctacccgctgaccccgatgcaggaaggcctgttgctgcacacgctgctggag
ccgggcacgggtctctattacatgcaagaccgctaccgcatcaacagcgccctcgacccc
gtgcgtttcgcccaggcctggcaggcggtgattgcccgtcacgaggccttgcgcgcctcg
ttctgctggaacgtcggcgaagacatgctgcaagtgatccacaagccgggcagcacgccg
atcgaatacctggactggagccaggaaccggaaggcgaacacgaaccgcgtctgcaagcg
ctgctcaagcaagagcgtgaagccggtttcgatctgctcaaccaggcaccgttccacctg
cgcctgatccgcgtcggcgcggagcgctactggttcatgatgagcaaccatcacatcctc
atcgatgcctggtgccgttcgttgctgatgaatgacttcttcgagatctacatggccctg
ggcgaaggccgcgaggcgcaattggccatgccgccgcgttatcgcgactacattgcctgg
ctgcaacgccagaacctaaacgaggcacgccagtggtggcaacagaacctgcaagggttc
gagcgcaccacgccgatcccgagcgaccggccgttcctgcgtgaacacgcgggccacagc
ggcggcatggtggtgggcgattgctatacccgcctcgacgcccgtgacggtgcacaactg
cgcgagctggcccaggcccatcaactgaccgtcaacactttcgcccaggcggcatgggcc
ttggtgctgcggcgcttgagcggcgaccgtgacgtgttgttcggcgtcaccgtggccggg
cgcccggtggaaatgccggagatgcagcgtacggtgggcctgttcatcaacagcattgcg
ctgcgggtgaaattgcccgaggacgaccagcgttgcagcgtgcgccagtggttgagcggc
ctgctcgacagcaacatgcagctgcgcgagtacgaatacctgccgctggtgacccttcag
gaacacagcgaactgcccaagggccagccgctgttcgacagcctgtttgtgttcgaaaac
gccccggtggaggtctcggtgctggaccgcgcacacagcctgaatgccacttcggactcc
ggccgcacccataccaacttcccgctgactgccgtgtgctacccgggcgatgacctcgga
ttgcacttgtcctacgaccagcgctacttcgacgagaccaccgtgcaaggcatgctcggc
gagttcaagcgcctgctgctggcgctggtgcagggcttccacggcgacatggccgacctg
ccgctgattggcgagcaggagcgcgagttcctggtacagggatgtaaccagagcgagcat
gactacccgctggagcgcagctatgtcgaactgttcgaagcccaggtggccgcgcatccg
caacgcatcgccgccagctgtctcgatcagcaatggacctatgacgaactgaaccgccgc
agtaacggcctgggccacgccctgattgccgcaggcgtcggcctggaccaaccggtggca
ttgctggctgaacgtggccttgacctgtttggcatgatcatcggcagcttcaaggccggt
gccggctacctgccgctcgatccgggcctgccgagccagcgtttgcgcagcatcatcgac
ttgagccgcacaccgttgctggtgtgcaccgaagcgtgccgcgagcaggctatcgaactg
ctggaaggcttcgactgccagttgctggtgtgggaggaagtgcccgctcgcggggagaac
cccggcatctacagtggcccggacaacctcgcctacgtgatctacacctcgggctccacc
ggcctgcccaagggtgtaatggtagaacagcgcggcatgctcaataaccagttgagcaag
gtgccgtacctggccttggacgacgcggatgtgattgcgcaaaccgcttcgcagagcttc
gatatttccgtgtggcaattcctcgccgcgccgctgttcggcgcgcgggtggacatcgta
ccgaacaccctcgcgcatgatcctcaaggcctgttggagcatgtacaggcccagggcatt
accgtgctggaaagcgtgccatcgctgatccagggcatgttggcccaggaccgtattggc
ctggacggcctgcgctggatgctgccgaccggtgaggcgatgccgccggagttggcgcac
caatggctgctgcgctacccgcaggttggcttggtgaacgcgtacggtcctgcggaatgc
tcggacgatgtggcgttctaccgcgtcgacctggcgtcgacccgtggtacgtacttgccg
attggcacaccgaccgacaacaaccgcttgtacctgctcgatggtgcgctggaactggtg
ccgcaaggcgccgttggcgagctgtgtgtcgctggtacgggcgtcggtcgcggttacgtc
agcgacccattgcgcactgcgccggtgtttgtgccaaatccgttcggcgcactgggcgag
cgtctctaccgcaccggtgacctcgcgcgccgccgcagcgacggcgtgctggagtacgtc
ggtcgcattgaccaccaggtgaagattcgtggctaccggatcgagctgggtgaaatcgaa
gcgcgcctgcacgaacaaccggaagtacgcgatgccgcggtgggcgtgcaggagggcgtc
aacggcaagcatctggtcggctatctggtggtagctgatggaacgctcaacccaggcgag
cgcctggaccgcatcaagcaacgcctgcgcgctgagttgccggaatacatggtgccgttg
cactggctatggctcgaccgcctgccgctcaacgccaacggcaaactcgaccgcaaggcc
ttgccggccctggagatcggccagttgcacagccaggattacctggcgccgcgcaacgag
ctggaaaccaccctggccgccatctgggccgaggtgctgaaagtcgacagggtaggggtg
caggacaacttcttcgaactgggtgggcactcgttgctggccacgcagattgcctcgcgg
gtgcagaaaaccctgcaacgtgacgtgccgctgcgagcgatgttcgagtgcagtacggtg
gcggagttggctgagtatatcgaggggctggcggcgaatgagatcagtgccgagaaggtg
gatcgcttgagtgatttgatggcagagctggaggggctgtaa

DBGET integrated database retrieval system