KEGG   Pseudomonas lurida: A7318_19140Help
Entry
A7318_19140       CDS       T04730                                 

Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00860  Porphyrin and chlorophyll metabolism
pfx01100  Metabolic pathways
Module
pfx_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A7318_19140
Enzymes [BR:pfx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     A7318_19140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: AOE80612
UniProt: A0A5E6XHV8
LinkDB All DBs
Position
complement(4246956..4248011)
Genome map
AA seq 351 aa AA seqDB search
MTDTWWLNPCKAIDAQAYEHALARQQQLTKPAGSLGQLEALAVQLAGLQGQVKPSVDRLW
IAIFAGDHGVVAEGVSAYPQAVTGQMLQNFVSGGAAISVLARQLDAQLDVVDLGTVTSSL
DLPGVRHLNIGTGTANFVHGPAMTEAQGQLALQAGRDSARRALANGTQLFIGGEMGIGNT
TAASALACALLDCQVSDLTGPGTGLNAQGVSHKVAVIERALALHAGQRGDALQTLFNLGG
FEIAALVGAYLACAQEGIVVLVDGFICTVAALVATRLNPACREWLVFGHGGAEPGHRHVL
QSLDAKPLLELGLRLGEGSGAALAVPLLRLACALHGQMATFAEAAVADRPA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacctggtggctcaacccttgtaaggcgatcgacgctcaagcgtacgaacac
gctctggcacgccagcagcagctgaccaagccggccggctccctgggccagctggaagcg
ctggcagtgcaattggctggcttgcagggccaggtcaagccatcggtggatcggctgtgg
atcgccatcttcgctggcgatcatggcgtggttgcagaaggagtgtcggcatatccccag
gcagtcactgggcagatgctgcaaaacttcgtcagcggtggcgcggccatcagcgtattg
gcgcggcaactggatgcgcagttggacgtggtcgacctggggacagtgacctcgtccctg
gacctgcccggtgtgcgtcacctgaacatcggcacgggcaccgccaacttcgtccacggt
ccggcgatgaccgaggcccaggggcagctcgccctgcaagccggtcgtgacagtgcacgg
cgtgcgttggcaaacggtacgcaactgtttatcggtggcgagatgggcatcggcaacacc
accgctgccagtgcgttggcgtgtgccttgcttgattgccaggtcagcgacctcacgggg
cctggcaccgggttgaacgcccagggcgtcagccacaaggtggcggtgatcgaacgcgca
ctggcattgcatgccggccagcgcggtgatgcattgcagacgttgttcaatcttggcggc
tttgagattgccgcgctggtgggtgcgtatctggcctgtgcccaggaaggcatcgtggtg
ctggtggatgggtttatctgtaccgtcgcggcgctggtcgcgacgcgcttgaacccggcg
tgccgcgagtggctggtgttcggccatggcggtgccgaaccgggtcatcgccatgtgctg
cagagtctcgacgccaagccactgctggaacttggcttgcgcctgggtgagggcagcggt
gctgcgttggcggtgccgttattgcgcctggcctgtgcgttgcatgggcaaatggcgacc
ttcgccgaagccgccgtggcggaccgcccggcatga

DBGET integrated database retrieval system