KEGG   Pseudomonas lurida: A7318_19440Help
Entry
A7318_19440       CDS       T04730                                 

Definition
(GenBank) beta-ketoacyl-ACP synthase III
  KO
K16872  beta-ketodecanoyl-[acyl-carrier-protein] synthase [EC:2.3.1.207]
Organism
pfx  Pseudomonas lurida
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7318_19440
Enzymes [BR:pfx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.207  beta-ketodecanoyl-[acyl-carrier-protein] synthase
     A7318_19440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III ketoacyl-synt Thiolase_N Chal_sti_synt_N
Motif
Other DBs
NCBI-ProteinID: AOE80669
LinkDB All DBs
Position
complement(4304221..4305342)
Genome map
AA seq 373 aa AA seqDB search
MHNVVISGTGLYTPANSISNEELVQSFNAYVHQFNSDNADAIERGEVQALTESSAAFIEK
ASGIKSRFVMDKDGILDPQRMTPRLPERSNDEWSVLCQMAVGAAEQALQRAGKTAADIDG
VIVACSNLQRAYPAIAIEVQEALGIEGFGFDMNVACSSATFGIQNAANSIQLGQARAILM
VNPEVCTGHLNFRDRDSHFIFGDAATAVVLERADLATSKHQFDVVSTKLLTKFSNNIRNN
FGFLNRTAPEGVGAPDKLFVQEGRKVFRDVCPMVAELIGVHLEENQLNVTDVKRFWLHQA
NLSMNHLIVKKLLGREASVEEAPVILDTYANTSSAGSVIAFHTYQDDLPEGSIAVLSSFG
AGYSIGSVILRKR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgcataacgtcgtcatcagcggcactggcctgtacaccccggccaacagcatctcaaac
gaagagctggtgcagtctttcaatgcctacgtgcatcagttcaacagcgacaatgccgac
gccatcgagcgcggtgaagtgcaggcgctgactgaatccagtgcagccttcatcgaaaaa
gcctcgggtatcaagagtcgcttcgtgatggacaaagacggcattctcgaccctcagcgc
atgaccccacgcctgcccgagcgcagcaacgacgagtggtcggtactctgccagatggcc
gtcggcgccgctgaacaagccctgcagcgcgccggcaagaccgccgctgacatcgacggt
gtgatcgtcgcctgttccaacctgcagcgcgcctacccggccatcgccattgaagtccag
gaagccctgggcatcgagggttttggatttgacatgaacgtggcgtgctcctcggccacc
ttcggcatccagaatgccgccaacagcatccagctggggcaggcgcgggcgatcctgatg
gtcaacccggaagtctgcaccggtcacctgaacttccgcgaccgcgacagtcacttcatc
tttggtgacgcggccactgccgtggtcctggagcgtgccgacctggcgacctccaagcat
cagttcgacgtggtaagcaccaagctgctgaccaagttctccaataacatccgcaataac
ttcggtttcctcaaccgcactgcgccagagggtgtcggcgcgccagacaagctgttcgtg
caggaaggccgcaaggtgttccgtgatgtgtgcccgatggtggctgagctgattggcgtg
catctggaagaaaaccagttgaacgtaaccgatgtgaaacgcttctggctgcaccaggcc
aacctgagcatgaaccacctgatcgtgaagaaactgctgggccgtgaagcgtcggtggaa
gaagcaccggtgatcctcgatacctacgccaacaccagctcggcggggtcggtgattgcg
ttccacacctaccaggatgacctgcccgagggctccattgcggtgctcagttcgttcggc
gcgggttactcgatcggcagcgtgatcctgcgcaaacgctga

DBGET integrated database retrieval system