KEGG   Pseudomonas fluorescens L228: A7318_21160Help
Entry
A7318_21160       CDS       T04730                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pfx  Pseudomonas fluorescens L228
Brite
Enzymes [BR:pfx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A7318_21160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOE80996
UniProt: A0A075PCA9
LinkDB All DBs
Position
4670415..4671011
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVEAFWN
LVNWKFVAEQFEGKTFTA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccctacgcacacgatgccctgcagccgcacatctcc
aaggaaaccttggaatatcaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtgccaggcaccgagttcgaaggcaagaccctggaagagatcgtcaaatcctct
tcgggcggcatcttcaacaacgccgctcaggtctggaaccacaccttctactggaactgc
ctggcgccaaacgctggcggccaacccaccggcgcgctggctgaagccatcaacgctgcg
ttcggttcgttcgacaagttcaaggaagagttcaccaagacgtccgtcggcaccttcggt
tccggttggggctggctggtgaaaaaagccgacggttccctggccctggccagcaccatc
ggcgccggcaacccgctgaccagcggcgacactccgctgctgacctgcgacgtatgggaa
cacgcctactacatcgactaccgcaacgtgcgtccaaagtatgtggaagcgttctggaac
ctggtcaactggaagttcgtggctgagcagttcgaaggcaagaccttcactgcctaa

DBGET integrated database retrieval system