KEGG   Pseudomonas lurida: A7318_25525Help
Entry
A7318_25525       CDS       T04730                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00330  Arginine and proline metabolism
pfx01100  Metabolic pathways
pfx01110  Biosynthesis of secondary metabolites
pfx01130  Biosynthesis of antibiotics
pfx01230  Biosynthesis of amino acids
Module
pfx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    A7318_25525
Enzymes [BR:pfx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     A7318_25525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N NAD_binding_2 ApbA GFO_IDH_MocA UDPG_MGDP_dh_C Shikimate_DH PDH
Motif
Other DBs
NCBI-ProteinID: AOE81830
LinkDB All DBs
Position
5629413..5630231
Genome map
AA seq 272 aa AA seqDB search
MSNTRIAFIGAGNMAASLIGGLRAKGLDAAQIRASDPGADTRARVSAEHGIETFADNAEA
IRGVDVIVLAVKPQAMKAVCESLRASLQPQQLVVSIAAGITCASMNNWLGAQPIVRCMPN
TPALVSQGVSGLYATAEVTAEQRGQAQELLSAVGIALWLEQEQQLDAVTAVSGSGPAYFF
LLIEAMTAAGVKLGLSKDVAEQLAEQTALGAAHMAVASDVDAAELRRRVTSPGGTTQAAI
ESFQAGGFEALVEKALGAAAHRSAELAEQLGK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacgcgtattgcctttatcggcgccggtaacatggcggccagcctgatcgga
ggcctgcgggccaagggcctggacgccgcgcagatccgcgccagcgaccccggcgccgac
acccgtgcgcgcgtcagcgccgagcacggcattgaaacctttgccgacaatgccgaggcc
atccgtggcgtcgatgtgattgtgctggcagtgaagccacaggccatgaaggctgtgtgc
gaaagcctgcgtgcgagcctgcagccgcagcagttggtggtgtccatcgccgccggcatc
acctgcgccagcatgaacaactggctcggcgcccagccgatcgtgcgctgcatgcccaac
accccagccctggtcagccaaggcgtgagcgggttgtacgccaccgccgaagtgaccgcc
gaacaacgcggccaggcgcaggagctgctgtcagccgtgggcattgccctgtggctggaa
caggagcagcaactggacgcggtcaccgcggtgtccggtagcggcccggcctatttcttc
ctgctgatcgaagccatgaccgccgccggggtgaagctggggctgtccaaggacgttgcc
gagcaactggccgagcagaccgccctgggcgccgcgcatatggcggtcgccagcgatgtg
gacgccgctgagttgcgccgccgcgtgacctctcccggcggtaccacacaggcggccatc
gagtcgttccaggccgggggctttgaagccctggtagaaaaagcattgggtgccgctgcg
caccgctcggcggaactcgccgaacaactgggcaaataa

DBGET integrated database retrieval system