KEGG   Pseudomonas lurida: A7318_25710Help
Entry
A7318_25710       CDS       T04730                                 

Definition
(GenBank) GTPase SAR1
Organism
pfx  Pseudomonas lurida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3482 MMR_HSR1 RsgA_GTPase FeoB_N Ras GTP_EFTU Roc AIG1 SRPRB
Motif
Other DBs
NCBI-ProteinID: AOE81866
LinkDB All DBs
Position
5665646..5667013
Genome map
AA seq 455 aa AA seqDB search
MTKPLKLAVVGHTNVGKTSLLRTLTRDVGFGEVSHRPSTTRHVEGARLSVDGEALLELYD
TPGLEDAIALLDYLERLDRPGERLDGPARLARFFEGSEARQRFEQEAKVLRQLLASDAGL
YVIDAREPVLAKYRDELHVLASCGKPLLPVLNFVSSSDHREPDWREALARLGLHALVRFD
SVAPPEDGERRLYESLALLLEHARPQLERLILDQEAQRQERQQSAARLIAELLIDCAACR
RSVVTEDEQQAIGDLRKAVRQREQTCVEALLKVFGFRPQDAAASDLPLLDGRWGDDLFNP
ETLKQLGVRVGGGIAAGAAAGAGVDLLVGGLTLGAAALAGAIAGGALQTARSYGSRLLGK
IKGHRELTVDDSVLRLLALRQRQLLKALNLRGHAAMHSIKVDTTQDKTWREGKLPDALHK
ARAHPQWSSLNPHAKLSQAERQEQVQALALRLDET
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcccctgaaactcgccgtggtcggccacaccaacgtcggcaagacctcgctg
ctgcgcaccctcacgcgtgacgtgggcttcggcgaagtctcccatcgccccagcaccacg
cggcatgtcgaaggcgcgcggttgtcagtggatggcgaggccttgctggagctgtacgac
acgccaggccttgaagacgccatcgccctgctcgattacctggagcgcctggaccgcccc
ggcgaacgcctcgacggcccggcacgccttgcgcgcttctttgagggcagcgaagcccgc
cagcgttttgaacaggaagccaaggtgctgcgccaactgctggcctcggacgccggcctg
tacgtgatcgacgcccgcgagccggtactggccaagtaccgcgacgagctgcacgtgctg
gccagttgcggcaaaccgttgctgccagtgctcaacttcgtcagcagcagcgaccaccgc
gagccggactggcgcgaagccctggcccgtcttggcctgcacgcgctggtgcgattcgac
agcgtggcgccgccggaagacggcgagcggcgcctgtatgaaagcctcgccttgctgctg
gaacacgcgcggccacagctggagcggttgattcttgaccaggaggctcaacgccaggag
cgccagcaaagcgccgcgcggttgatcgccgagctcttgatcgactgcgccgcctgccgc
cgcagcgtggtcaccgaggatgaacagcaagccatcggcgacctgcgtaaagccgtgcgc
caacgcgaacaaacatgcgtggaagccttgctcaaagtgttcggctttcgcccgcaggat
gccgccgccagcgacttgcccttgctcgatgggcgctggggcgatgacttgttcaacccc
gaaaccctcaagcaactgggcgtgcgcgtcggcggtggtatcgccgcaggcgcggccgcg
ggtgccggtgtggatctattggtcggtggcctgacgctcggcgccgccgccctcgcgggt
gcgattgccgggggcgcgctgcaaaccgcgcgaagctatggcagccggctgctgggcaag
atcaaaggccaccgagagttgaccgtcgacgacagcgtattgcgcctgctcgccctgcgt
cagcgccagttgctcaaggcgttgaacctgcgcggccatgcggcgatgcacagcatcaag
gttgatacgacccaggacaaaacctggcgcgaaggtaaattgcccgatgcgttgcacaag
gcccgcgcccacccgcaatggtcgtcgctcaacccccacgccaaactcagccaggccgag
cgccaggaacaggtccaagcattggccctgcgcctggacgaaacctaa

DBGET integrated database retrieval system