KEGG   Pestalotiopsis fici: PFICI_00250Help
Entry
PFICI_00250       CDS       T04924                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00020  Citrate cycle (TCA cycle)
pfy00190  Oxidative phosphorylation
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
pfy01200  Carbon metabolism
Module
pfy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfy_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFICI_00250
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PFICI_00250
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PFICI_00250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 19265263
NCBI-ProteinID: XP_007827022
UniProt: W3XLS7
LinkDB All DBs
Position
Unknown
AA seq 640 aa AA seqDB search
MANTSLNAVLSRCPMSGEVIFLHALTRIFANQPLRAKEASAHVSSKYPVIDHEYDAIVVG
AGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVK
GSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSKSYGKGGQAYR
CCAAADRTGHALLHTLYGQSLRHSTNYFIEFFALDLIMEDGECRGVLAYNQEDGTLHRFL
AQNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLIT
EGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHVYLQL
SHLPAEILAERLPGISETAAIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGEVLTVDESG
NDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFTPGAKAKPISAD
AGAESIEVLDQIRNSEGPKSTAEIRLAMQKTMQTDVSVFRTQESLDEGVKKIHEVDQMFP
QVGIKDRSMIWNSDLVETLELRNLLTCATQTTVAAANRKESRGAHAREDYPDRDDENWMK
HTLTFQKKPQGDIELGYRRVIGTTLDEKECAAVPPFKRTY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggctaacacgtctctcaatgcagttctctcgcgctgcccaatgtcaggcgaggtcatt
ttcctccacgcgctcactcgcatctttgccaaccagcctctgcgggcaaaggaggcttcc
gcacacgttagcagcaaatacccggtcattgaccacgaatacgatgccatcgtggtcggt
gccggtggtgcaggtctgcgagccgccttcggtcttgctgaggccggtttcaacacagca
tgtatatcaaaactgttcccgaccagaagtcacacggttgccgcccagggtggtatcaat
gccgcactaggaaacatgcacgaagatgactggagatggcacatgtacgataccgtaaaa
ggatcggattggctgggtgaccaggatgctattcactacatgacccgcgaggcccccgcc
tccatcatcgaattagagaactacggatgccccttctcgagaactgaggatggcaagatt
taccagcgtgcctttggtggtcaatcgaaaagctacggaaagggtggccaggcataccga
tgctgcgctgccgctgaccgaactggccacgccctgctgcacactctctacggtcaatct
ctacgacacagcaccaactacttcattgagttcttcgccctcgacctgatcatggaggac
ggcgagtgccgtggtgtcttggcttacaaccaggaggacggtaccctacacagattcctt
gcccagaacactgttctcgccactggtggttacggacgtgcctacttcagctgcacgtct
gctcacacatgtactggtgatggtatggccatggttgctcgtgctggtcttcccaaccag
gatctggagttcgtccaattccaccctactggtatctacggagctggttgcttgattacc
gagggttctcgtggtgagggtggttacctcctcaactctgagggtgagcgtttcatggag
cgttacgcccctaccgccaaggatcttgcctcgcgtgatgtcgtctcccgatccatgacc
atggaaatccgtgagggacgtggtgtcggtcccgagaaggaccacgtctacctgcagctc
agccacttgcctgctgagattcttgctgagcgtctgcccggtatctctgagactgccgcc
attttcgccggtgtcgatgtccgcaagcagcccattcccgtcctgcccaccgtccactac
aacatgggtggtatccctaccagatacactggtgaggtcttgaccgttgatgagtccggt
aacgacaaggttgtgcccggtctgttcgcctgtggtgaggctgcttgtgtctctgtccac
ggtgccaaccgtcttggtgccaactccctcctggatctggttgttttcggtcgtgctgtg
tcccacaccatccgtgacaacttcactcctggtgccaaggccaagcccatctctgccgac
gctggtgccgagtccatcgaggtcctcgaccagatccgcaactcggaaggtcccaagagc
actgccgagatcagactggccatgcaaaagaccatgcagactgatgtcagcgtcttccgt
acccaggagtcgttggacgagggtgtcaagaagatccacgaggtcgaccagatgttcccc
caggtcggcatcaaggaccgcagcatgatctggaactcggaccttgttgagactctcgag
ttgagaaacttgttgacttgcgctacccaaactactgtggctgctgccaaccgtaaggag
tctcgcggtgctcacgcccgtgaggactaccctgacagagacgacgagaactggatgaag
cacaccctgaccttccagaagaagccccagggtgacattgagctcggctacagacgtgtc
attggcacgacgctggacgagaaggagtgcgcagctgtcccgcctttcaagcgtacttac
taa

DBGET integrated database retrieval system