KEGG   Pestalotiopsis fici: PFICI_01110Help
Entry
PFICI_01110       CDS       T04924                                 

Definition
(RefSeq) Hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00010  Glycolysis / Gluconeogenesis
pfy00051  Fructose and mannose metabolism
pfy00052  Galactose metabolism
pfy00500  Starch and sucrose metabolism
pfy00520  Amino sugar and nucleotide sugar metabolism
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
pfy01200  Carbon metabolism
Module
pfy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pfy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFICI_01110
   00051 Fructose and mannose metabolism
    PFICI_01110
   00052 Galactose metabolism
    PFICI_01110
   00500 Starch and sucrose metabolism
    PFICI_01110
   00520 Amino sugar and nucleotide sugar metabolism
    PFICI_01110
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PFICI_01110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfy04131]
    PFICI_01110
Enzymes [BR:pfy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PFICI_01110
Membrane trafficking [BR:pfy04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PFICI_01110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 19266123
NCBI-ProteinID: XP_007827882
UniProt: W3XP48
LinkDB All DBs
Position
Unknown
AA seq 429 aa AA seqDB search
MNPTWVMAFPDGYETGTYLALDMGGTNLRVCEITLTDNKSEFDIIQSKYRMPEELKTGES
EELWEYIADCLQQFIDTHHGELPPDAEKIPLGFTFSYPATQNYIDEGILQRWTKGFDIDG
VEGNNVVPMLEAALESRKVPIKVSALINDTTGTLIASAYTDPKMVIGCIFGTGCNAAYME
TCGAIPKLAHMNLPPDCPMAINCEWGAFDNEHKVLPRTPYDIIIDKESPRPGQQAFEKMI
AGLYLGEIFRLVLVDLHDNKDVHIFEGQDIKKLRRPYSLDASFLSAIEDDPFENLQETAD
LFSDKLSIATTRPELELIRRTAELIGTRAARLSACGVAAICKKKNFSSCHVGADGSVFNK
YPHFKARGAQALKEILDWPAKKSLREEDPIEILAAEDGSGVGAALIAALTLKRVNAGNLA
GILHPEHFK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgacgtgggtcatggctttccctgatggctacgagacgggtacttatttggcc
ttggatatgggcggtacgaacttgcgtgtgtgtgagatcaccctgacggataacaagtcg
gaattcgacatcatccagtccaagtaccgtatgcccgaggagctcaagaccggagagtcg
gaagagctgtgggaatatattgccgactgccttcaacaattcattgacactcaccacgga
gagctgccaccagacgccgagaagatcccgcttggtttcaccttctcatacccggcaacc
cagaactacatcgacgagggtatcctgcagcggtggaccaagggttttgacattgacggc
gtcgagggcaacaacgttgtccccatgttggaggccgctctcgaatcgcgcaaggtaccc
attaaggtctctgccttgatcaacgataccaccggtacactcattgcttcggcctacacg
gatcctaagatggtcattggctgtatctttggcacaggctgcaacgcagcatacatggag
acttgtggcgccatccccaagctggctcacatgaacctgcctccagactgccccatggct
atcaactgcgaatggggtgcctttgacaacgagcacaaggtcctgccgcggacgccttac
gatatcatcattgacaaggagtcacccagacctggacagcaggcattcgagaagatgatc
gcaggtctctacctgggcgagatcttccgactggtcctggttgaccttcacgacaacaag
gatgtccacattttcgagggccaggatattaagaagcttcgcagaccttacagcctggac
gcatccttcctttcggctatcgaggatgacccctttgagaacttgcaggagactgctgat
ttgttctctgataagctcagcattgcaaccacccgtcctgagctcgagctcatccgtcgt
acagctgaactgatcggcacacgtgctgctcgtctttccgcgtgcggtgtcgctgccatt
tgcaagaagaagaacttctcttcatgccacgttggcgctgacggctccgtcttcaacaag
tatccccacttcaaggctcgtggtgctcaggcactcaaggagattcttgactggcctgcc
aagaagagtttgcgggaggaagaccctatcgagatcctcgccgccgaggacggtagtggt
gtgggtgctgctctgattgcagcgttgacactcaagagagtcaacgctggaaaccttgct
ggtatcctccaccccgagcacttcaaataa

DBGET integrated database retrieval system