KEGG   Pestalotiopsis fici: PFICI_01539Help
Entry
PFICI_01539       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
Organism
pfy  Pestalotiopsis fici
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 DUF5053 Glutaredoxin GST_C
Motif
Other DBs
NCBI-GeneID: 19266552
NCBI-ProteinID: XP_007828311
UniProt: W3XR63
LinkDB All DBs
Position
Unknown
AA seq 625 aa AA seqDB search
MDPTSTQFQSPPGLLVHGLPSGPAPNPQPDHQNPHLALHHNISVSGPPPHHFSLPTLPSH
GEISLGVLDAANPSVFHQHAHPHSHTHSLPELPHLPPNPTVPILRPTPHPHSLEAPPSVT
ANPPPPPPPPHSAPPSHGPPGNRPPSFGITPPAPLPPTITQLQQDDEFNSSASSGTPLVV
EPAESRPHGQLVNKIVVDPPDLEAWRNKFFNVDEMILLTNDEFETYFPHIDNVYSHRSTQ
KYKRKPFVSHYWDCRMKGRPPGTPKSNDPLKKKRKRSARERDLCDVKIKITEYFPGATLQ
LDDGVGSYSTPQQFFDSNGMPIQPGANGEKFWTIQRVNGNGGNGKGDGVAGPHKHTLEKS
DEIKKSTVQRYINAQKKESKKTVKPAQKRASGAALVTARKHAKDHELKLYAACFCPFSQR
VWIALEVKQMQYQYCETDPYKRTTQLLEANPRGTVPAIREGDWACGESSIILEYLEDHDK
RVPLFPTDPRLKANCRLWIDHINSTIVLSYLALLKATDPSQQSEHQTRLSNEILELVQAA
DERGPYFLGADLCLVDIHFAPFVLRLSRILADLRGWRQPAANTRWEQWVQAIESNSHIQA
TTSNNDLYLETADLSVTGQQHSHLL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggaccctacgtcgactcagttccaatcgccgcccggcctgctggttcatggactgcca
agcggccctgcgccgaaccctcagccggaccaccagaacccccatcttgcccttcaccac
aatatctccgtctccggccctccgccgcatcacttctccctgccgaccctgccgtcccat
ggcgaaataagcctcggcgtgctcgacgccgccaacccttccgtctttcaccagcacgcc
cacccgcattcgcatactcattccctgcccgagcttccccatctcccgcccaacccaacc
gtcccaatccttcgtccaacgcctcatccgcattcgctggaagcgccgccctcggtcact
gctaatccaccccctccgccgccgccgccgcattcggcccctccaagtcatggccccccc
gggaatcggccgccgtcgtttggtattaccccgccggcacctctgccgccgacgattacc
cagcttcaacaggatgacgagttcaatagctcagcttcgagcgggacgccgcttgtagtc
gagccggcagaaagcaggccacatggccagttggtgaataagatagtcgtcgatccgcca
gatctagaagcctggcgtaacaagttcttcaacgtcgatgaaatgatactcttgaccaac
gacgagttcgaaacctactttccccatatcgataatgtatactcgcatcgctccacgcaa
aagtacaagcgtaaaccgttcgtgtcgcactactgggattgccgtatgaagggccggcct
ccgggcacgcccaaatccaacgatccactcaagaagaaacggaagcggagtgcacgggag
agagacttgtgcgacgtcaagatcaaaattacggaatactttcctggcgctactctgcag
cttgacgatggcgtcggctcatactccactcctcagcagttctttgattccaacggcatg
ccaatccagccgggggcgaatggggagaagttttggacaattcagcgtgtaaacggcaat
ggagggaatggaaagggagatggtgttgctggtcctcataaacacaccctggagaaaagt
gacgagatcaaaaagtccacggtacagaggtacatcaatgcgcagaagaaggagtccaag
aagaccgtaaaacccgcccagaaaagggcttcgggagctgctttggtcacagcacggaaa
catgccaaagaccatgagctgaagctctatgccgcatgcttttgtccgttttcccagcga
gtatggatcgctttggaagtaaagcagatgcaataccaatactgtgaaaccgatccgtac
aagcggactacacagcttctcgaggccaatccccgcggcacagtccctgccatccgagaa
ggtgattgggcgtgcggggagagctccatcatccttgaatatctggaggatcatgataag
agggttcctctgttccctacggacccacgactcaaagctaactgtagattatggattgat
catatcaactctacaattgtgttatcttatcttgcactgctgaaagcaacagatccgtca
cagcagagtgaacatcaaactcgattatcaaacgagatcttggagcttgtacaggctgct
gacgagagaggtccctactttctaggtgcagacctgtgccttgttgacattcactttgcg
ccattcgttctgcggctttctcgaattcttgctgaccttcgcggctggcgtcaaccagct
gctaatacgcgctgggaacaatgggttcaagccattgagagcaactcgcacatacaagcc
accactagcaacaatgatctgtatcttgaaacagctgatctctcagtgactggtcaacag
cacagtcatcttttgtag

DBGET integrated database retrieval system