KEGG   Pestalotiopsis fici: PFICI_01779Help
Entry
PFICI_01779       CDS       T04924                                 

Definition
(RefSeq) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00020  Citrate cycle (TCA cycle)
pfy00190  Oxidative phosphorylation
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
pfy01200  Carbon metabolism
Module
pfy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfy_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pfy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFICI_01779
  Energy metabolism
   00190 Oxidative phosphorylation
    PFICI_01779
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PFICI_01779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2 DNA_pol3_tau_4
Motif
Other DBs
NCBI-GeneID: 19266792
NCBI-ProteinID: XP_007828551
UniProt: W3XRT1
LinkDB All DBs
Position
Unknown
AA seq 282 aa AA seqDB search
MAALRSTSSRLLASASRPAFVKPAAIFSRSMASVGDATVQATPKGADDSRMKTFQIYRWN
PDQPTEKPRMQSYTLDLNKTGPMVLDALVRIKNEVDPTLTFRRSCREGICGSCAMNINGT
NTLACLCRIPTDTKDMKIYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAPDGREY
RQSKADRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDERKGER
KAALDNSMSLYRCHTILNCTRTCPKGLNPGLAIAEIKKEMSF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcagctctccgctctacctcatcgaggctcctggcctcggcctcgcgaccggccttt
gtcaagcctgccgccatcttctcccgctcaatggcttcggtcggtgatgccaccgtccag
gctacccccaagggcgccgacgactcccgcatgaagaccttccagatctacagatggaac
cccgaccagcccaccgagaagccgcggatgcagtcctacaccctcgacctcaacaagacc
ggacccatggtgctcgacgccctcgtgcgcatcaagaacgaggtcgacccgaccctgacc
ttccgccggagttgccgtgagggtatctgcggctcctgcgccatgaacatcaatggcacc
aacacactggcttgcctgtgcagaatacctaccgacaccaaggacatgaagatttacccc
ttgcctcacacctacgtcgtcaaggatctcgtgcccgacttgacgcacttttacaagcaa
tacaagtccatcaagccttacctgcagagagatactcccgcacctgatggcagggaatac
cgccagagcaaggccgaccgcaagaagcttgacggtctgtacgagtgtatcctgtgcgcc
tgctgctcaacgtcgtgcccgtcgtactggtggaactcggaggagtacctgggccctgcc
atcctgctgcagtcgtaccgctggctcgccgactcgcgtgacgagcgcaagggtgagcgc
aaggccgccctcgacaactccatgagcttgtaccgatgccacaccattctcaactgcaca
cggacttgccccaagggtctcaaccccggtctcgccattgccgagatcaagaaggagatg
tctttctaa

DBGET integrated database retrieval system