KEGG   Pestalotiopsis fici: PFICI_03263Help
Entry
PFICI_03263       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy03030  DNA replication
pfy03410  Base excision repair
pfy03420  Nucleotide excision repair
pfy03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PFICI_03263
   03410 Base excision repair
    PFICI_03263
   03420 Nucleotide excision repair
    PFICI_03263
   03430 Mismatch repair
    PFICI_03263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pfy03032]
    PFICI_03263
   03400 DNA repair and recombination proteins [BR:pfy03400]
    PFICI_03263
Enzymes [BR:pfy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PFICI_03263
    6.5.1.6  DNA ligase (ATP or NAD+)
     PFICI_03263
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PFICI_03263
DNA replication proteins [BR:pfy03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PFICI_03263
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PFICI_03263
DNA repair and recombination proteins [BR:pfy03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PFICI_03263
   NER (nucleotide excision repair)
    Other NER factors
     PFICI_03263
   MMR (mismatch excision repair)
    Other MMR factors
     PFICI_03263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 19268276
NCBI-ProteinID: XP_007830035
UniProt: W3XGP4
LinkDB All DBs
Position
Unknown
AA seq 890 aa AA seqDB search
MASPAKKRKLNKDNKQSAIPSRGLEYFFAKQNKNGYTSNANTDQETAGATEGDHEMTDEA
LAMKLQAEWDAEVAAERRNDQALQQTESAKSHADAVATDNTCGIQDTGQIEVPKKSASPV
SLPAEPKGKSTLSLQSVAASVDTVSESIPMDQSPLTFDPSAFVSQLKEHWASEDGSASYA
LLTRCFVLVSSTSSRIKIVDTLVNCLRIIIEADPESLLPAVWLATNSISPPYISLELGLG
GSAISKALKQVCGLDNRSLKAIYDKYGDAGDVAFEAKKKQSFTLRKPKPLTIKGVYQALV
KIASSQGQGSAETKQRIVDRLLHDARGGEESRFIVRTLCQHLRIGAVKTTMLIALSRAFL
LSRPPGADFELKSTEELSKLKKEELAEVWGRAEEIVKACFARRPNYSDLIPVMLEIGVCD
ELLLRCGLTLHIPLRPMLGSITRDLSEMLTKLQGRDFACEFKYDGQRAQVHCDEKGKVSI
FSRHLEVMTDKYPDLVDLVPKIRGEGVSSFIMEGEVVAVDRQTGELKTFQTLTNRARKDV
AIGSITIDVCLFAFDLMYLNGQPLLDRSFRERRDMLKSLFTEIPHHFTWVKNLDATSQDS
DAVLDFFKQATDIKCEGIMVKILDNLHDLPAPAHVDSNQDTTSENTPTAKSKGKANSTAS
EKKTRRKPLLATYEPDKRLDSWLKVKKDYSASFDTLDLVPIAGWHGQGRKAKWWSPILLA
CRNEETGQLEAVCKCISGFTDAFYKANKAHYDDGSGEPDADDRNEQDDEQVDEEANRDAE
DVEKRYKNIRRTKPSFVEYNGHPDVWFEPQEVWEMAFADITLSPTYTAAIGLVSQDRGLS
MRFPRFLKKRDDKGIDEASTSEFLAGLWRKQEAKAPPPPIKEDDEDEDDG
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccccgcgaaaaagcggaagctgaacaaggacaacaagcaatcggcaatacct
tccagaggcttggagtacttctttgccaagcagaacaagaatggatatacttcaaatgca
aacaccgaccaagagacagcgggtgcaacggagggagatcatgagatgacggacgaggca
ctggccatgaagctgcaggccgagtgggacgcggaagtcgcagcggaacgacggaacgac
caagcgctgcagcagacggagagcgcaaagtctcatgcggatgctgttgctaccgacaat
acatgtggcattcaagatactgggcagatagaagttccaaagaaatctgcttcaccagtg
tcacttccagccgagccaaagggcaagagcacgctctcgctacagtccgtggctgcttca
gtagacacagtatcggaatccatcccgatggaccagagccctctgacatttgatccaagt
gcattcgtgtctcagctgaaagaacactgggctagcgaggatggcagtgcttcatatgca
ctactgacacggtgtttcgtcctagtgagcagcacctcaagtcggatcaagatcgtggac
acgttggtcaactgcctccgcatcatcattgaagctgatcccgagagcctgctccccgcg
gtgtggttggctacaaactccatttcgccgccctacatctccctcgaattgggactagga
gggtcggccatctcaaaggcgctcaagcaggtgtgcgggctggacaatcgctcgctcaag
gccatttacgacaagtatggcgatgcaggcgatgtggcgtttgaggccaagaagaagcag
agctttactctccgaaagcccaagccgcttaccatcaagggcgtataccaggctctagta
aagattgcaagcagccagggccagggcagtgccgagaccaagcagcggatcgtcgatcga
ctgctacatgatgcgcggggtggtgaggagagtcgctttatcgtacggactctatgtcaa
cacttaagaatcggcgcagtaaagacgaccatgctcatcgccctgtctcgagcttttctc
ttgtcgcgccccccaggcgcagactttgagctcaagtccaccgaggagctgtcaaaattg
aagaaggaggaactcgccgaggtttggggtcgagccgaagagattgtcaaggcatgcttt
gcacgaagaccaaactacagcgacttgatcccagtcatgctcgagattggcgtttgcgat
gagcttcttttgcgctgcggactgacattgcacatcccgctacgacccatgctgggaagc
atcacaagggatttgtcagagatgctcaccaaacttcaaggccgggactttgcctgtgag
ttcaagtacgacggtcagagagcgcaagtccactgcgatgaaaaaggcaaagtttccatc
ttctcacggcatcttgaagtcatgacagacaaatatccagacctcgtggatctcgttccg
aaaatccgcggcgaaggtgtgagcagcttcatcatggagggcgaagtggtagccgtagat
cggcaaaccggtgaactcaaaacctttcaaacattaacgaatcgagcgaggaaagacgtg
gctattggaagcatcactatagacgtctgcttgtttgcatttgacttgatgtacctcaac
gggcagcctctgttagaccgatcatttcgtgaacgaagagacatgctgaaatctctgttt
accgagatcccccaccacttcacctgggtcaagaatctggatgccacgtctcaagactcg
gacgctgtcctcgacttctttaaacaagcaaccgacatcaaatgcgagggtatcatggtc
aagatcctggacaatttacatgacctgcccgcgcccgctcatgttgactccaaccaggat
acaacgtcggagaacacacccacggccaagtccaaaggcaaagcaaattccacagcctcg
gagaagaaaactcggcggaagccgctacttgctacgtatgagccagacaaacgccttgac
tcatggctcaaggtcaaaaaagactacagcgcctcctttgataccctagatctcgttccc
attgctgggtggcatggtcaagggcggaaagccaagtggtggtctcctatcttgctggca
tgtcgcaatgaggagacgggccagcttgaggctgtttgcaagtgcataagtgggttcaca
gacgcattttacaaggccaacaaggcgcactatgacgatggttcaggcgaaccagatgcg
gacgataggaatgagcaagatgatgagcaggtcgatgaggaagccaaccgagacgctgag
gatgtggagaaaaggtacaagaacatccgcaggacgaaaccaagctttgtagagtacaat
gggcacccagatgtgtggttcgagccacaagaagtgtgggagatggctttcgctgatatt
acactttcgcctacctacaccgcggcgattggactggttagtcaggatagaggcttgagc
atgcgtttccctagattcttaaagaagagggacgataaaggtatagatgaagcgagtact
agtgagtttcttgcagggctttggaggaagcaagaagcaaaagcaccgcctccaccgata
aaagaggatgatgaggacgaagatgatggctag

DBGET integrated database retrieval system