KEGG   Pestalotiopsis fici: PFICI_03415Help
Entry
PFICI_03415       CDS       T04924                                 

Definition
(RefSeq) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PFICI_03415
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PFICI_03415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 19268428
NCBI-ProteinID: XP_007830187
UniProt: W3XH79
LinkDB All DBs
Position
Unknown
AA seq 214 aa AA seqDB search
MSSPTYKLPPLPYAYDALEPSISKQIMELHHSKHHQTYITNLNKALEVSAKALSEGKLED
SAAQLAAIRFNGGGHINHALFWENLAPSSSSDSKPDAAPKLVAAIKDTWGSLDGFKKAFG
AALLGIQGSGWGWLVKEAGTGQLRIATLANQEAVVVGDTPLFGVDMWEHAYYLQYLNGKA
AYVENIWNVINWKTAEQRYAGAREDAFKILKANM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcccacatacaagctccctcctctgccatatgcatacgatgccttggaaccc
agcatctcgaagcaaatcatggagctacaccactccaagcaccaccagacctatattaca
aacctcaacaaggcactagaagtctcggccaaggccctgtcggagggtaagctcgaggac
tcggccgcccagctcgccgcgatccgcttcaacggcggcggccacatcaaccacgcgctg
ttttgggagaacctggccccgtcgtcatcgagcgactccaagcccgacgcggcgcccaag
ctggtcgcggccatcaaggacacctggggcagcctcgacggcttcaaaaaggcgttcggt
gcagccctgctgggcatccagggcagcggctggggctggttggtcaaggaggccggtacg
ggccagctgcgcatcgccaccctcgccaatcaagaggccgtcgtggttggagacacaccg
ctcttcggcgtcgacatgtgggagcacgcctactacctccagtatctcaatggcaaggca
gcctacgtcgaaaatatctggaacgtcatcaactggaagacagctgagcagcgatacgcg
ggagcccgggaggatgcattcaagatcctcaaggccaacatgtaa

DBGET integrated database retrieval system