KEGG   Pestalotiopsis fici: PFICI_04735Help
Entry
PFICI_04735       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pfy  Pestalotiopsis fici
Brite
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PFICI_04735
Chromosome and associated proteins [BR:pfy03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PFICI_04735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Shugoshin_C Adaptin_binding RTP801_C
Motif
Other DBs
NCBI-GeneID: 19269748
NCBI-ProteinID: XP_007831507
UniProt: W3XA04
LinkDB All DBs
Position
Unknown
AA seq 1252 aa AA seqDB search
MAAPGGSGGQQANNPTGDASLTTNNINTGADADLLRSLNQLSLSTPDTRSPSRASSTSPH
PARTVSRLDHLTVATPSQRRSSTSKSPASHIQTPTRSSTPTLLRKASTNSLHSANGGPVH
RAPSRRSSSALHSPTFAKLTGNGSSQHAIEEDVRFSKTEADVAREYFIRELDIHHISNPD
PRTETLVILQDACYNHRYQRPFAGKGNLATIVERPERLQAVYTGVAMAYVRLGERHQDGK
APIDADLDPSTLQVPFDIRKTERKLSLNAPAVTNVHGAKWMEELAILCNAAEAKLQAGSL
EIQRPEMDRGHGAKAPEPFHKGDLYLSPESLSAFEGALGATCEAVDAVFSTSATKRVFVA
VRPPGHHCDTSFPHGFCWLNNVHVGIMHGFLNHGLTHAAIIDFDLHHGDGSQDIAWEYNQ
RKHWSKGNAAQWKKSSIGYFSLHDIQSYPCEQGDLEAVKKASLCIEDAFSQTIWNVHLQQ
WKDHADFWYQYRTRITIVLEKARAFLRRETEKCRAAGQEPRAAIFFSAGFDASEFESAGM
QRHKVNVPTEFYARISRDVVKMSFEEGLSVDGRIVSCLEGGYSDRALSSGVLAHLSGLAG
GDVRAKEDAALGHSRNGSRRISLSASPLGRRGTISSVESDARSKAPGFPYDSSWWSVPEL
DRLDAARFVPKPQPRPVREGPVPTYCSPTQSSNAKVTELAKLRRTVSGLSNADAATHVVA
RAPTPPPPLVYWPSAALELSRLLIPVGGQVDSITWDALKSEETRIKREQKEIKDQKEREK
LRLSSSPSDQLIDGSGTPALRKSGRERKPVSYAEPEDPNKHRRRTVAGAAILATDKAAAR
GTSNVAGSTHNRHPSRRLSASSAISTMTADTAVPYVPTVEPSLGVPARPGTAQTDRPDTS
LSIRTTPGPLSVPKTRPVASRKDSTKSTGTNARKSKPAASKAPRKDAKSKGLAASRSTAQ
SSNLSSPVRPPGNQLDAGSSTEAARASSTATPDSGNDISNITSGMKKIKINVVTKEMKEA
REKAAKERESATATPVLENHPTPLEQSSSTPTDNVPVGAEYENDQLPGVDSNNADSAPAI
EQAQPLPVTPQKENQPVDMDMDLPEQPPTDVPITPVHDPQTIDEPQDSALFIPYQPEGPP
AQAIPQTAPTKWVTPNTVETPVPYRGHNFTATSAIPFSPAKPIRADTPMSKNSSVFGRQV
PFASNKPANHNLSAFGNDATATSGHTEPGSSEDAKTWDPTMEIPETPEHKRP
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccaggcgggtctggtggccagcaggccaacaaccccacgggcgatgcttcg
ctgacaacgaacaatatcaacactggtgcagatgccgatctgcttcgctcacttaaccaa
ctctcactctcaacccctgacacgaggtcaccctcccgagcttcttctacatcgccacat
ccagcacgtaccgtctcccgactcgatcacttgactgtcgcgacgccttcgcaacgtcgc
agctctacatccaagagtcctgcctcgcacattcaaacccctacacgatccagtactcct
actcttttgcgcaaagcatccacgaattcactgcattcagccaacggcggtcccgtccat
cgcgccccatcacggaggtcgagttcggcactccattcgccaacttttgccaagttgact
ggtaatggaagcagccaacatgctatcgaggaggacgtgcggttcagcaagaccgaggcc
gatgttgctcgggagtatttcattcgcgagctcgatattcaccacatatcgaatccagac
ccaagaaccgagacactggtcatactccaagatgcttgttacaatcacagataccaacgg
ccctttgccggcaagggtaacctagcgaccattgttgagcgtcccgaaagactgcaggct
gtgtacacgggtgttgccatggcttatgtgcgacttggcgaaagacaccaggatggcaag
gccccgattgacgcagacctagatcccagtacactgcaagtaccattcgatattcgcaaa
acggagcgcaaactctctttgaatgcgccggctgtcacaaatgtacatggtgcaaagtgg
atggaagagctggcaatactctgcaatgcagcagaagcaaaattacaagctggcagtctg
gagatccaacgcccagaaatggatcgagggcatggcgcaaaggctccggagccatttcat
aagggagacctctatctttcgcccgagtcgctctcagcattcgaaggtgccctaggcgca
acatgcgaggcagtcgacgctgtcttttcaacctccgctacaaagagagtttttgtagcc
gtacgcccgcctggccatcactgcgacaccagcttcccgcacgggttctgctggctcaac
aatgttcacgttggaatcatgcatggctttttgaatcatggtcttactcatgcggctatc
atcgactttgatcttcaccacggagatgggtcacaagacattgcgtgggagtataaccag
cgcaaacattggtcgaagggcaatgccgctcagtggaagaagagtagcattggctacttt
agtctccacgatattcagtcatacccttgtgagcaaggcgacctggaggctgtcaagaaa
gccagtctctgtatcgaagatgccttctcccagacaatctggaatgtacatctccagcag
tggaaagaccacgccgacttttggtatcagtaccgaacgcgaatcacaatcgtcctcgaa
aaggctcgggccttcctacggcgtgagacggagaaatgcagagctgctggtcaggagcct
agagctgccatcttcttctcggccggctttgacgcaagcgagtttgagtcggctggcatg
cagcgccacaaggtcaacgtgcctaccgagttctacgcacgtattagccgtgatgtcgtc
aagatgtcgttcgaagagggcctatctgttgatggccgtatcgtgagttgtcttgagggt
ggatacagcgatcgagctctgtcctctggcgtcctggctcatctcagcggacttgccggt
ggtgatgtacgtgctaaagaggatgcagccctcggccatagccgtaatggcagtcgtcgt
atcagcttgagcgcaagtcccctaggccgacgaggcacgatttcttccgtggagtctgat
gccaggagtaaggcacctggtttcccttacgactcttcgtggtggagtgtaccggagctg
gaccgactggacgcggctcgatttgtccccaagccacagcctcgtccggtccgtgaaggc
cccgttccgacttattgttcacccacgcagtcgtccaatgccaaagtcacagagctcgcc
aagcttcggcgtacagtatctggattatctaatgctgatgccgcaacacatgttgtagct
cgagcgccaacgcctcctcctcctctggtctattggccttcggcggctctggaactgagc
agacttttgatacccgtcggtggtcaggttgacagtatcacgtgggatgcactcaagtca
gaggagactcgaatcaagagagaacagaaagaaatcaaggatcaaaaggagcgcgagaag
ttgagattgtccagcagccccagtgatcaactgatcgatggatccggcacacctgctctc
agaaagagcggccgtgaacgcaagcctgtctcatacgccgaacctgaagaccctaataag
caccgcaggaggacagtcgcaggagctgcaattttggctactgacaaggccgctgcacgt
ggtacatccaatgtggccgggtcaacacataaccgccatcccagccgccggctgagtgca
tcttctgctataagtaccatgactgctgatacagctgtcccgtatgtaccgacagtcgag
ccttcgcttggagttccggctcgtccagggaccgctcaaacagatcgtccagacacatct
cttagcatccggaccactcccggcccgttatccgttccaaaaacgagacccgtagcgagt
aggaaggatagcaccaagtccacaggtacaaatgcgaggaaatcaaagcctgccgcatcc
aaggcaccaaggaaagacgccaagagcaaaggcttggctgccagtcggtcaactgcacaa
tccagcaacttatcaagcccagtccgaccaccgggcaatcaactggacgcgggctcttca
acggaagctgctagggcatcatccaccgccacacccgattcaggaaacgatattagcaac
attactagcggtatgaagaaaattaagatcaatgttgtaacgaaagagatgaaagaagca
cgagagaaggctgctaaagagagggaatcagcgactgcaactccagtcctcgagaatcat
cctacacccttagaacagtctagctcgacaccgactgacaatgttccagttggggccgag
tatgaaaatgatcaacttccaggtgtcgattcaaacaatgccgattccgcaccagctatt
gagcaggcacagccgctgccagtcacgccccagaaggagaaccagcctgtagatatggac
atggatttgccagaacagccgccgactgatgtgcccattacgccggtccatgatccacaa
actatagatgagccgcaggactctgctctcttcattccttaccagccggaaggcccgccc
gcccaagcaatcccacagacagcgccaaccaaatgggtgactccgaatacggtggaaacg
ccggtcccgtaccgtggtcataactttaccgcaacgtcggccatacccttctcaccagca
aaacctatccgagctgacactcctatgagcaagaattcttccgtctttggccgacaagtt
ccgtttgcttcaaacaaacccgcaaaccataacttatcggctttcggcaatgatgccacc
gctacatctgggcacaccgagccgggcagttctgaggatgccaagacgtgggatcccaca
atggaaattccggagactcctgagcacaaacgtccgtga

DBGET integrated database retrieval system