KEGG   Pestalotiopsis fici: PFICI_04941Help
Entry
PFICI_04941       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00052  Galactose metabolism
pfy00511  Other glycan degradation
pfy00600  Sphingolipid metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PFICI_04941
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PFICI_04941
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PFICI_04941
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PFICI_04941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 Big_1 DUF1908
Motif
Other DBs
NCBI-GeneID: 19269954
NCBI-ProteinID: XP_007831713
UniProt: W3XAI5
LinkDB All DBs
Position
Unknown
AA seq 902 aa AA seqDB search
MHAKHPSFLSLFLGSTILAGLNQNFGSASAVPRADTSGRNRTRLHEGWKFQLWPKAPDGI
TYDLRPDNTGQDLEVLKPWILPSANAFIPNETDHYSQPVGQPETVIPYVSPSFNDSSWSD
VEVPHDWAITEAFVSRSITSGDMGRLQVQGVGWYRRPLEISTSDRGKHIYLEVDGAMSYA
MVWLNGQLVGGWPYGYNSFRMDLTPYIDFSGDTNNLAIRVENPQDDSFSRWYPGAGIYRN
VWLEKVNSAVHVAQYGTTFVSSEVSSKSATLDLSVRISNKASNETSNITVITEVHNFDSP
SGSVGRMVATFPARSQSISPGATVQVNSTITISKPYLWGPPPLQHPNMYMAYTRLYNDGD
LLDTYTSTFGIRTIDFDPNNGLHVNGQKVFIQGVNQHHDLGALGTAFNVRAATRQLQILQ
ELGVNTIRLSHNPPAPELLKLTDELGCLVLDEIFDNWAEGKRDSDFSLIWQDWHEADLRA
FVRRDRNHPSIFLWSFGNEVLEASDDKELAGQIAANLTNIVTMEDPSRPSTASIFRSVPG
EAFPNALKVLGINYLGEGARYGEAYVNLTGYRTDPLYEPFHNEYPERMIFGSEVAASASS
RGTFTFPVTQYDSCPIDDSHGGNSTTSTISGYEIYTADSGSSPDRVFKTQDEYPFVAGGI
VWSGFDYLGEPVPYRTSARSSYYGIIDLAGFKKERFFLYQSRWRPDLPMAHIVPHWNWPE
RDGQVTPVHVFTSGDEAELFINGKSQGRKKRGAFEYRFRWDDTIYTAGNVSVITYKNGTR
WAEDIKKTTGKPAALQLTADRATIIADGEDLSFVTVTVLDSNGDTVPEAANKITFSVEGQ
GRIVATDNGLPTDMTRFTSLSRNTFSGLALAVVEGLSGLPGKIVLTAKADGLTSANITIT
TT
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcaaaacatccatcttttctttccctcttcctcggctcgaccatcctggctggc
ctaaatcaaaattttggctcagcgtcagcagttccgcgggctgatacctctggtcgcaac
agaactagactgcacgaaggatggaaatttcaattatggcccaaggcgccagatggaatc
acttatgacttgcgcccagacaacacgggacaagatttggaagttctgaagccttggatc
ctgccgtcagcaaatgctttcatcccgaacgagactgatcactactctcagccggtaggc
caacccgagactgtgattccatatgtctctccatcattcaacgactcaagctggagcgac
gttgaggtgccccatgactgggcaataactgaagcctttgtttctcgctcaatcacctct
ggtgacatgggccgccttcaggtccagggagttggctggtatcgtcgcccgcttgaaatc
tccacatctgaccggggaaaacatatttatctcgaagttgatggcgcaatgtcctacgct
atggtgtggctgaatggccagctggtaggaggatggccgtacggctacaactcgtttcga
atggacctcacgccttacatcgatttcagtggggacaccaacaatttggctattcgtgtc
gagaacccgcaagatgattctttttcaagatggtatcccggggctggtatctaccgcaat
gtatggcttgagaaggtcaacagtgctgttcatgtagcccagtacggtacaacctttgtt
tctagcgaggtttcttcgaagtctgcgacattagacttgtcagtacggatatcaaataag
gcttcaaacgaaacgtccaacataacagtcatcaccgaagtccacaatttcgactcaccg
agtggaagtgttgggaggatggtcgctacatttccagcaaggtcccaaagtatctcgcct
ggtgcaacagtccaagtgaacagcactataactatttcaaagccctatctctggggtcca
ccacccctacagcacccgaatatgtatatggcgtatacacgcctgtataatgacggtgac
ttgctggatacatacactagcacgtttggcattcgcaccattgatttcgaccctaacaac
ggcttgcatgtcaatggtcagaaggtttttatccaaggtgtgaaccaacatcatgatctt
ggcgctcttggcactgccttcaatgttagagctgccactcgccagctccaaattttacaa
gagctcggcgtgaacacaattcgtctctctcataatccgccagcaccagaactcctgaag
ctcacagatgagctgggatgtctcgttctcgatgagatatttgacaattgggccgaggga
aagcgtgactcggactttagtctgatatggcaagattggcacgaggctgacttgcgagcg
tttgttcgacgtgatcgaaaccatccttcaatcttcttgtggagttttggtaatgaagtc
cttgaagcaagtgacgacaaagaactggccggccagatcgctgcgaatctgaccaatatt
gtgaccatggaggatccaagtcgtccctcgactgcatccatctttcgatctgtgccgggt
gaagcgtttcccaatgcgttgaaggttctaggaatcaattacctcggggaaggagctcgc
tatggtgaagcatacgtcaacctcacaggctacagaaccgatcctctatacgaaccattc
cacaatgagtatccagaaagaatgatatttggctctgaggtcgccgcctccgcaagcagc
cggggtacttttacttttcccgtcacccagtacgacagctgtccgatagatgatagccat
ggtggaaattccactacgagcaccatcagtggctacgaaatctacactgccgattctgga
tcctctccggatcgagtgttcaagacacaagacgaatatccattcgttgctggtggcatc
gtctggagcggttttgattaccttggtgagccagtaccatatcgtacttcagcccgcagc
tcttactatggtatcattgatctggctggattcaagaaggaaagattcttcctatatcaa
tcacgatggcgccccgatctaccaatggcacatattgtcccacattggaattggccagag
cgtgacggccaggtaaccccggtgcatgtgtttacgtcaggcgatgaagcagaactattc
ataaatggcaaatcgcaaggccggaaaaagaggggagctttcgagtatcgtttccgctgg
gatgatacgatctacaccgcaggcaatgtcagtgtgataacctataaaaatgggacaagg
tgggcagaggatatcaagaaaacaactggaaagcctgctgctttacagcttacggcagac
cgagccacgattatcgctgatggggaagacttgtcttttgtcacagtaactgtcctcgac
agtaacggcgacaccgtaccagaagctgcgaacaagattacattttctgtagagggacag
ggaaggattgtagcaacagacaacggcttgccgacagatatgactcgtttcacttccttg
tctcgaaacacattcagcgggttggcgcttgcagtcgtcgagggattatcggggctgcct
ggcaagatcgtccttacggccaaggctgatgggctaacatcggcgaatatcacgattaca
actacatag

DBGET integrated database retrieval system