KEGG   Pestalotiopsis fici: PFICI_06613Help
Entry
PFICI_06613       CDS       T04924                                 

Definition
(RefSeq) alpha/beta-glucosidase agdC
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00052  Galactose metabolism
pfy00500  Starch and sucrose metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PFICI_06613
   00500 Starch and sucrose metabolism
    PFICI_06613
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PFICI_06613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19271626
NCBI-ProteinID: XP_007833385
UniProt: W3X8V6
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MASLIVFAAAAAAAAVLRRDYPSDTTLTACPGYKASNVQTTASSLTADLTLAGEACNVYG
ADLTDLILEVSYDTETRLHVKIQDAANDVYQVPESVFPRPEVDGGYPTAQSALTFNYTEE
PFSFTVSRTATGEILFDTSAASLVFESQYLRLRTKLPEDPYLYGLGEHSDPFRLNTTDYI
RTIWSQDSYSVPEGSNLYGNHPVYFEHREGGTHGVLFLNSNGLDVFVNNTEESGQYLEYN
SLGGVLDFYFIAGPSPVEVAQQYAGVVGLPAMQPYWSLGFHQCRYGYQDAFDVAEVVYNY
SQAEIPLETMWTDIDYMYRRRVFSLDPDRFPLSKMRELVDHLHANNQHYIVMVDPAVAYQ
DFPGTLQRGIDDNVFMLRSNGSVWKGVVWPGVTAFPDWFSANITTFWNNEFAEFFSPETG
VDISGLWIDMNEPSNFPCYFPCDNPDYYAIGYPPEPPAVRSPPRELPGWSCDFQPEGTDC
EQSEVATRDIEVVEPRDGFTGSEDHVWFSKRQEGQQLGLPDRDLLYPKYPIHNKAAYQDD
WNADKGGISNKTVNTDLIHQNGLTMYDTHNIYGSMMSVASREAMLARKPTLRPLIITRST
FVGAGAKVGHWLGDNLSTWWHYRLVIRSMFSFTAIYQIPMVGADTCGFGSNTTEQLCARW
AALGALTPFYRNHNDIAAISQEFYRWDSVADVARKFINIRYQLLDYLYTALYHQTTDGTP
NVLPLFYVYPEDKTTWDLELQYFLGPGLLVAPVTEENATSVDIYLPNDIFYDFYTHEKVE
GQGAYITREDQSISDLPLYYRGGVIVPLRANSSMTTTDLRKQDFEIVIPVNANGTAQGEL
YLDDGVSLEQTGVTAITFAFDGTYLTAEGTFNYETELKISKVTVLGSPSSKKCRRSVSVD
VNQPLTEGFKIQVV
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcttgatcgtctttgccgcagctgcggcggcggcggccgtccttaggcgggac
tatccgagcgacacgacgctgacagcttgtccgggatacaaggcttcaaacgtgcagacg
actgcatctagtttgactgcagaccttaccttggctggcgaggcatgcaatgtctatggt
gccgacttgaccgacttgattctcgaggtttcttacgatacagagacccggttgcatgtc
aagattcaagatgccgccaatgacgtataccaggtccccgagtccgtctttccccggcca
gaggttgacggaggctacccaacagcacagtctgctctcaccttcaactacactgaagag
ccattctcctttaccgtctccaggacagcgaccggcgagatcctttttgacacttctgcc
gccagcttggttttcgagtctcaatatctccggctgcgaaccaagctccccgaggatcct
tacttgtacggcctgggcgagcactctgatcctttcaggctaaacactacagactacatt
cgcacgatttggtcgcaggattcctactctgtccccgagggttcaaacctctacggtaac
cacccagtctactttgaacaccgtgaaggcggcactcatggtgtcctcttcctaaattcg
aatggactcgatgtctttgtcaacaatacggaagagtctggccagtacctcgagtacaat
tccctcggaggtgttctcgacttttacttcatcgccggtccttctccggtcgaggtcgcc
cagcaatatgccggtgtcgtaggtctgccagcgatgcagccgtactggtcgcttggcttc
caccagtgccgttatggataccaggacgcctttgacgttgccgaggtcgtctacaactac
agccaagcagagattccgctggagaccatgtggacggatattgactacatgtaccgccgc
agagtcttctcgttggatcctgacaggttccccctctccaagatgagggagctggtcgac
cacctccatgccaataaccaacactacattgtcatggtggatccagcagtggcctaccaa
gacttcccgggtaccctccagcgcggtatcgacgacaatgtcttcatgctccgctccaac
ggttcggtatggaaaggtgtcgtctggccaggtgtgacagctttccctgattggttttcg
gcgaatatcacgacattctggaacaacgaatttgccgagttcttttcacccgagactggt
gtagatatctcaggtctttggatcgacatgaacgaaccatccaacttcccatgctacttt
ccgtgtgacaatccggactactatgccattggttaccctccggagcctccggccgtgcga
tcgccaccaagagagctgcctggttggtcttgcgatttccagcccgagggcacagattgc
gagcagtctgaagtggcaactcgggatattgaagttgttgagccccgagacggctttact
ggctcagaggatcatgtttggttttccaagcgtcaagaaggccaacaactaggtcttcct
gacagagatttgctatatcccaaataccccatccacaataaggcagcttaccaagatgat
tggaacgccgacaagggtggtatttcaaacaagactgtcaacactgacctgattcaccag
aatgggctcaccatgtacgatacccataatatctacggatcaatgatgagtgttgcatcc
cgtgaagccatgctggcacgcaaacctaccctccggcctcttatcattacccggtcaaca
ttcgtaggtgctggtgccaaggtcggtcattggctgggcgacaacctgtcgacatggtgg
cactaccgtctagtgattcgctcaatgttttctttcacggccatttatcaaattccaatg
gttggcgctgatacctgcggttttggctcaaacacgaccgagcagctctgtgccagatgg
gcagcactaggtgcccttactccattttaccgcaaccacaacgacattgccgctatttct
caagagttctatcgctgggattcggtcgcggacgtggccagaaaatttatcaacatccga
taccaacttctcgattacctgtacacggccctctaccatcaaacgactgacggtacccca
aatgttctgccccttttctatgtctatcccgaggacaagacgacctgggatctggaatta
cagtacttcctcggacccggcctcttggttgcccccgtgaccgaggagaacgcgacgagc
gtcgacatttatctgcccaatgacatcttctacgacttttacacgcacgaaaaggtcgag
ggccaaggtgcatacattacgcgcgaggaccagagcatatcggatctccccttgtattac
cgaggcggtgtcatcgtcccgctccgcgccaactcgtccatgacgacaacagacctgcgc
aagcaagactttgaaatcgtcattcctgtcaatgccaatggtaccgcccagggcgagctt
tatctcgatgatggcgtgagccttgagcagaccggtgtcacggccatcacatttgctttt
gatggcacatacctgacggccgagggtacctttaactatgagactgagctcaagatctcc
aaggttacggttttgggctcgccgtcatccaagaagtgccgacgcagtgttagcgttgat
gtgaaccaaccccttactgagggtttcaagatccaggttgtctag

DBGET integrated database retrieval system