KEGG   Pestalotiopsis fici: PFICI_08174Help
Entry
PFICI_08174       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
Organism
pfy  Pestalotiopsis fici
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 19273187
NCBI-ProteinID: XP_007834946
UniProt: W3X3J4
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MGDWSRTGLIDEPCNSTSSASTKSTGHTMDDSSNDDGLRVERLLEQRSQLTDQLLESPYD
LMLYLGRAVVYADLGYPDLAAGDAYKALLLTDEVSDESFEFHEQSLEALEKYQHGPLPTV
LDHGLLSQMAGTEDVQCDANMLARVGSVRAYQILSLGLLLIGCLKSAHTFCERGLSIAPD
NQELLNVRHYIVTVGQRRLRQTNFDPNDLPEWGMVRREVYPWNDHEPDRFSDESLEFLNR
ELSTMAPKCAVQVATLPVLLEAASDMDNYQVIPTCKQLGVFATEDIAAGETVLEEYSLVT
ANNRLKESVCDACSEELPPLGSESTAVNCEECYDTVFCSQFCYDKAQELYHPAVCDKDVD
SIAKDTDARNADEALHLLLLARILAMAAHQDMHPLDVSQIKYIWGDFVSSRENEIDPSPN
AGPPPQWTLPFSFTYNIETPFHILEKMDIDVYATVAQHDLWVLNTLYSKFRGTASARKNP
RDGRPDVAAVHPFWCLANHDCDPNVTWNWGGRMVLKARETRVVGNRPGGIRKGEEILNHY
CDVTIPVQDRREWARGSLGGWCMCSRCREEAAAASTSTDTNTNGWQTH
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggtctcggacggggctgattgacgagccatgcaactcgacatctagtgcc
tctaccaaatctaccggccataccatggacgactcttccaacgatgatggccttcgcgta
gaacgtctcttggagcaacgtagccagctcaccgatcagcttctcgagagcccgtacgac
ttaatgctgtacttgggtcgtgccgtagtctatgctgacctgggctacccagacctggcc
gccggcgatgcttacaaggctctgctattgaccgacgaggttagcgacgaaagtttcgaa
tttcatgaacagtctctcgaagcgcttgaaaagtatcagcatgggccactgccgaccgtg
ttggaccatgggttgctcagccagatggcaggtacggaggatgtgcaatgcgacgccaac
atgctggctcgcgtaggctctgttcgtgcttatcagatcctcagccttggcctcctcctc
atcggctgccttaagagcgctcataccttctgcgagcgtggactttctattgcgccggac
aaccaggagttgctcaacgtacgccactacatcgtgaccgtcgggcagcgtagactgcgc
caaaccaactttgatcccaatgatctgccagaatggggcatggtacgacgagaagtgtac
ccatggaacgaccacgagccggaccgcttttctgacgaatcgctcgaattcctcaacaga
gagctctcaactatggctccgaaatgcgccgttcaggttgcgaccctaccagtcttgctc
gaggccgccagcgacatggataactaccaggtcattccgacctgcaagcagctgggagtt
tttgccacggaggatatagcagccggggagaccgtgcttgaggaatactcactagtcact
gccaataatcgcctgaaagaatccgtttgcgacgcctgcagtgaggagttaccgccactt
ggcagcgagtccacggcagtgaactgcgaggaatgttacgatacagtcttctgtagtcaa
ttttgttacgacaaggcccaggagctgtatcatcccgctgtctgtgacaaggacgttgac
tcgattgccaaagacacagatgctcggaacgcagacgaggcactccatctcctgctcctc
gcacgcatcctcgcaatggctgcgcaccaagatatgcaccctttggatgtgagtcaaatc
aagtacatctggggtgactttgtatcctcgcgggagaatgaaatcgatccgtcgccaaat
gctggaccaccaccgcagtggacgttgccattctcgttcacatacaacattgaaactccg
tttcacatcttggagaagatggacattgacgtgtatgccacggttgcacagcatgatttg
tgggtcctcaacacgctgtatagcaaatttcgcggaactgcatcggctcgcaagaatcca
cgtgacgggagacccgacgtggctgctgttcatcccttctggtgccttgcaaatcacgac
tgtgaccctaacgtgacatggaactggggtgggcgcatggtgctcaaagctcgcgagact
cgtgttgtcggcaacaggcctggcggcatccgcaagggtgaggaaatccttaaccactac
tgtgacgtgactatacctgtgcaagaccgccgggaatgggctcgtggtagtctaggcgga
tggtgtatgtgctccagatgtcgtgaggaagcggcagcagcatcaacaagcacagacacg
aataccaatggctggcaaacccattga

DBGET integrated database retrieval system