KEGG   Pestalotiopsis fici: PFICI_09106Help
Entry
PFICI_09106       CDS       T04924                                 

Definition
(RefSeq) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00250  Alanine, aspartate and glutamate metabolism
pfy00410  beta-Alanine metabolism
pfy00430  Taurine and hypotaurine metabolism
pfy00650  Butanoate metabolism
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
Module
pfy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFICI_09106
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFICI_09106
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFICI_09106
   00430 Taurine and hypotaurine metabolism
    PFICI_09106
Enzymes [BR:pfy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PFICI_09106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19274119
NCBI-ProteinID: XP_007835878
UniProt: W3WZG0
LinkDB All DBs
Position
Unknown
AA seq 515 aa AA seqDB search
MVHLASIPNDEEINKLPEAVRKVTLKLANEEDQFTTSVYGSKFAAQDLPRHEMPDGEMPK
DVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMSDSFSKNFIDYEEYPVSADIQNR
CVSMIGRLFNAPTHSESEGAVGTSCIGSSEAIMLGVLAMKRRWQKKRRAEGKSTEHPNIV
MSSAVQVCWEKATRYFEIDEKLVYCTPERYVIDPEETVSLVDENTIGICAILGTTYTGEY
EDVKAVNDLLVERGIDCPIHVDAASGGFVAPFVVPDLEWDFRLEKVVSINVSGHKYGLVY
PGVGWVVWRAAEYLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKRGYRS
IMSNLTRTADYLSEALEAMGFIIMSKKSGEGLPLVAFRLKPNEDREWDEFALAHKLRARG
WVVPAYTMAPHTEKLKMLRVVVREDFTKNRCDALIVDIKLCTELLESMDKESIKKHQEFL
RKHSVNSAQASHNHKNYKNEKHSIQGKHGKTHAVC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctcgcttccattcccaatgatgaggagatcaacaagcttcccgaggccgtc
agaaaggtgacgctcaagctcgccaacgaggaggaccagttcaccaccagcgtgtacggt
tcaaagtttgccgctcaggatctgccccgccacgagatgcccgacggtgagatgcccaag
gatgtcgcgtaccgcatgatcaaggacgagctgagcttggatggcaaccccatgctaaac
ttggcctcgtttgtaacgacttacatggaagaggaggctgagaagctcatgagcgactcc
ttttcaaagaacttcatcgactatgaagagtatcccgtgtcggcagacattcagaaccgc
tgcgtctccatgattggacgcctcttcaatgcgcccacccacagcgagagcgagggcgcc
gtcggtacatcatgtattggtagctccgaggccatcatgctgggcgtgctggccatgaag
cgccgctggcagaagaagagacgcgccgagggcaagtcgactgagcatcccaacattgtc
atgtcctctgccgtccaggtctgctgggagaaggcgacgcgctactttgagattgacgag
aagctcgtctactgcacacccgagcgctacgtgattgaccccgaggagactgtcagcctg
gttgacgagaacactattggtatttgtgccattctgggaacaacatacactggtgaatac
gaagatgtcaaggctgtaaacgatcttctggtggagagaggcatcgactgccctattcac
gtcgatgctgccagtggtggatttgtggcacccttcgttgtgccagacctcgagtgggat
ttccggctcgagaaggttgtgtctatcaacgtatctggtcacaagtatggtcttgtctac
cctggtgtcggttgggtggtctggcgtgctgccgagtacctccctcaggagctggtcttc
aacatcaactacctcggagctgaccagtcgtcattcaccctcaacttttccaagggtgcc
agtcaagtcattggtcaatactaccagctgatccgccttggaaagagaggataccgctcc
atcatgagcaacttgacccggacagcagactacctctccgaggccctagaggccatgggc
ttcatcatcatgtccaagaagtcgggcgagggtctgcccctcgtggcattccggctcaag
cccaacgaggaccgcgagtgggacgaattcgcgctcgcgcataagctgcgtgcccgcggt
tgggttgtccctgcctacaccatggcacctcacactgagaaattgaagatgctgcgcgtg
gtggtccgagaggactttaccaagaaccgctgcgatgcccttattgtcgacatcaagctt
tgcaccgagttgttggagagcatggacaaggaatccatcaagaagcaccaggaattcctc
cgcaagcactctgtgaacagcgcacaggctagccacaaccacaagaactacaagaatgag
aagcactccatccagggtaagcacggcaagactcacgccgtctgctag

DBGET integrated database retrieval system