KEGG   Pestalotiopsis fici: PFICI_10952Help
Entry
PFICI_10952       CDS       T04924                                 

Definition
(RefSeq) Glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00500  Starch and sucrose metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFICI_10952
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pfy01003]
    PFICI_10952
Enzymes [BR:pfy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PFICI_10952
Glycosyltransferases [BR:pfy01003]
 Polysaccharide
  Storage polysaccharide
   PFICI_10952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 19275965
NCBI-ProteinID: XP_007837724
UniProt: W3WT80
LinkDB All DBs
Position
Unknown
AA seq 732 aa AA seqDB search
MAAELPPLITRAEDSLEQPFSSQTANMSDDERPAREVKNHLLFEIATEVAHRVGGIYSVI
KSKAPVTTAEYGDRYTLIGPLNHQSAAVEVEELEPSNQELAKSIEAMRSRGIGILYGRWL
IEGAPRVLLIDTKTAYKYMDEWKTDLWNSASIPSPPNDDETNEAIVFGYLVAWFLGEFVC
HEKTRAVIAHFHEWLAGVAIPLCKKRRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFD
VDAEAGKRGIYHRYCIERAAAHSCDVFTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFS
AMHEFQNLHQQSKEKIHDFVRGHFYGHYDFVPEDTLYFFTAGRYEFRNKGVDMFIESLAR
LNHRLKSAGSKTTVVAFVIMPAQTTSLTVEALKGQAVIKSLRDTVDVIERGIGRRVFERS
LKWHEGDPLPDEKELITSADRVLLRRRLFAMKRHGLPPIVTHNMINDQEDPILNQIRRVQ
LFNHPSDRVKIVFHPEFLNSANPVLPLDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGV
PSITTNLSGFGCYMEELIENSSDYGIYIVDRRNKGVDDSVNQLTSHMFDFCQKSRRQRIN
QRNRTERLSDLLDWKRMGMEYVKARQLALRRAYPGSFAGDEEEDFIPGVEQKISRPFSVP
GSPRDRSGMMTPGDFASLQEGHESLSTEDYVAWKLPEEEDPDEYPFPLTLRTKKPSTSGA
ASPLDSIRLNGN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaactaccgccgctaatcactcgtgcagaagattcgctcgagcagcccttc
tcaagccaaaccgccaatatgagcgacgacgaaagaccggccagggaggtcaagaaccac
ctcctcttcgagatcgcgaccgaggtggctcatagagtcggtggaatctactctgtcatc
aagtcgaaagctcccgtcacgactgccgaatatggcgaccgatacaccctgatcggtcct
ctcaaccaccaatcggctgcggtcgaggtcgaagagctggagccttccaaccaagagctc
gccaagagcattgaggctatgcgaagccgcggcatcggtatcctctacggacgatggctg
atcgaaggtgccccccgtgtcttgctgattgacaccaagactgcctacaagtacatggat
gaatggaaaacagacttgtggaactctgccagtattccttccccaccaaatgatgacgag
acaaacgaggccattgtctttggttatctcgttgcgtggttccttggagagtttgtctgc
cacgagaagaccagggcggtcattgctcacttccacgaatggctcgccggtgtggctatt
cctctttgcaagaagcgcaggatcgatgtgaccaccatcttcaccactcacgcaactcta
ctcggccggtatctctgtgctggatcagtcgacttttacaacaacctgcaatggtttgat
gtggatgctgaagctggaaagcgtggcatttaccaccgatactgcatcgagcgagccgct
gctcactcttgcgacgtcttcacaactgtttcccacattacagcattcgaaagtgagcac
ttgctcaagcggaaacccgacggagtcttgcccaatggtctcaatgtcacaaagttctcc
gccatgcacgaattccagaacctgcaccagcagtcgaaggaaaaaattcacgacttcgtg
cgtggacacttctacggccactacgactttgtcccagaagacacgctctacttcttcacc
gccggtcgatacgaattcaggaataagggtgtagacatgttcattgagtcattggctcgt
ctgaaccacagactgaagtcggctggtagcaagacgaccgtggtcgcttttgtcattatg
cctgcccagacaacttcccttacggtggaagctctcaagggccaggccgtaatcaagtct
ctccgcgataccgtcgatgtcattgaacgtggcattggtcgccgtgtctttgagcgatct
ctcaagtggcatgagggcgacccgctccctgatgagaaggaattgatcaccagcgctgac
cgtgtcttgttgagacgacgtctgtttgccatgaagcgacacggtctgccaccgatcgtg
acgcacaacatgatcaatgaccaggaagacccgattctcaaccaaatccgtcgtgtccag
cttttcaatcacccaagcgaccgcgtcaagattgtcttccatccagagttcctgaattcg
gccaacccagtcttgcctctggattacgacgactttgttcgaggtacccatctaggtgtc
tttgcatcctactacgaaccgtggggctacacacccgccgagtgtaccgtcatgggtgtt
cccagcatcaccacgaacctttccggctttggttgttacatggaggagctgattgagaac
tcgagcgactatggaatttacattgtcgaccgacgtaacaagggagtggatgactctgtc
aatcagctcacgtcgcacatgtttgatttctgccaaaagagccgtcgtcaacgtatcaac
caaaggaacagaacagagcgacttagcgacctgcttgactggaagaggatgggcatggaa
tacgtcaaggcacggcaactcgcgctgcgccgggcataccctggatcatttgccggcgac
gaggaggaggatttcattccaggcgtcgagcagaagatttctcgacccttctctgtacct
ggctcccctcgtgatcgcagcggcatgatgaccccaggtgatttcgctagtctgcaggag
ggacacgaaagccttagcaccgaggactatgttgcttggaagctgcctgaggaagaggac
ccagacgagtaccccttccccttgacgcttcggacaaagaagccttcgacgtcgggagct
gctagccccttggacagcatcagactgaacggcaactag

DBGET integrated database retrieval system