KEGG   Pestalotiopsis fici: PFICI_11511Help
Entry
PFICI_11511       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00730  Thiamine metabolism
pfy00790  Folate biosynthesis
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PFICI_11511
   00790 Folate biosynthesis
    PFICI_11511
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfy04147]
    PFICI_11511
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pfy00537]
    PFICI_11511
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PFICI_11511
Exosome [BR:pfy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFICI_11511
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pfy00537]
 Enzymes
  PFICI_11511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 19276524
NCBI-ProteinID: XP_007838283
UniProt: W3WQN7
LinkDB All DBs
Position
Unknown
AA seq 589 aa AA seqDB search
MQPSQTTPLLADDRRHERRRSSLDSDMTDSEDDALRGDAPSTHHGRSWHLRLRETLIFIW
ALLATAGVLILAIWMSHKSQIGSEKPSGKRNLVFMVSDGMGPASLSLTRSFRQHVEGLEF
GDTLTLDKHFWGSSRTRSASSLITDSAAGATAFSCAQKSYNGAISMLPDHTPCGTVLEAA
KRAGFMTGLVVTTDITDATPACFASHVDVREQNDDIALQEIGEGPLGRVVDLMFGGGRCH
FLPNGTQGSCRADDIDVVSIAKEKHGFTYVDDRAGFDDFWEGKKEVPLPMLGLFAPTDIP
FEVDRRNMNDVYPSLSEMAKTAIKTLEKATANSDKGFFLMIEGSRIDHAGHINDPAAQVR
EVLEYDKTFKYVSDFLETSKTPGVLVATSDHETGGLSVARQNTVDYPEYLWYPAVLANAS
YSSLYLAHELHQHMSENKNKSEKELIAYINEKIVVPGLGILDATKEELAPIVQYPLLAQQ
VFANMVSRRAQIGWSSHGHSAVDVNIYSSGGPGTDSIRGNVENTDVGKFLRDYLNVDVGD
ITEELQEKMNRKPKSAAAAAADVEEAEQDHWAVHEDTVRQLEEHGVEEF
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttctcaaacaacgcccttgttggccgacgaccgtcgtcatgagcgacgtcgg
tcctctttagactcggacatgaccgattccgaggatgatgccctgcgaggcgacgctcct
tcgacacaccacggccgatcatggcacctgcgacttcgcgaaaccctcattttcatctgg
gctctgctcgccacggctggcgtcttgatcctggccatctggatgtcgcacaagtcacaa
atcggatccgagaagcccagtggcaagcgaaaccttgttttcatggtctccgatggcatg
ggtcccgcctcgctctcccttacacgatcgttccgacagcatgtggagggcttggaattc
ggcgacaccctgacgctcgacaagcacttttggggaagcagtcgaacacgaagtgcttcg
tccttgatcacggattccgcagctggtgccacggcctttagctgcgcgcaaaagagctac
aacggcgccatctccatgctgcctgaccataccccatgtggcacagtactcgaggctgca
aagagggctggtttcatgaccggcctggtcgtgaccacggatattacagatgccacgcct
gcttgctttgctagccatgttgacgtacgtgagcagaatgatgatattgcgcttcaggaa
attggcgagggtccccttggccgagtggttgatctcatgttcggaggaggaagatgccat
ttcttgcccaacggtacccaaggcagctgcagagctgatgacattgacgttgtgtctatt
gccaaggagaagcatggcttcacctacgtcgatgaccgcgctggctttgatgacttttgg
gagggcaagaaggaggttcccttgccgatgctaggtctctttgcccctaccgatattccc
ttcgaagttgatcggcgtaatatgaatgatgtttaccccagcttgagcgagatggccaag
actgccatcaagacactggagaaggctacagccaatagtgacaagggatttttccttatg
atcgaaggcagtcgcatcgaccatgccggccacataaacgatccagcggcccaggtgcga
gaagtcctggaatacgacaagacgttcaagtacgtttcggactttctcgagaccagcaaa
acccctggtgtgctcgtcgcaaccagcgaccacgagactggcggtctgtcggttgcaaga
caaaacactgtcgactatcccgagtacttgtggtaccctgctgttttggccaatgcatcg
tactcgtctctgtacctggctcatgagctgcaccagcacatgagtgagaataagaataaa
tccgagaaagaactcatcgcatacatcaatgaaaagatcgtcgtccctggactcggcatt
cttgatgccaccaaagaggagcttgcccccattgtccaatacccacttctcgcacaacaa
gtctttgccaacatggtcagcagacgtgctcagattggatggagctcccacggtcactca
gctgttgatgtcaatatctacagctccggcggcccaggaactgattccatccgcggaaac
gtcgagaacaccgacgtaggaaagtttctcagagattacctcaacgtagatgtcggtgac
attactgaagaattgcaagagaagatgaatagaaagccaaagtcggcagctgccgccgct
gccgatgtggaggaggctgaacaggatcactgggctgtccatgaggatacagtaaggcag
cttgaggaacacggtgtagaggaattctaa

DBGET integrated database retrieval system