KEGG   Pestalotiopsis fici: PFICI_11559Help
Entry
PFICI_11559       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00052  Galactose metabolism
pfy00500  Starch and sucrose metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PFICI_11559
   00500 Starch and sucrose metabolism
    PFICI_11559
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PFICI_11559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N zf-C2H2_assoc
Motif
Other DBs
NCBI-GeneID: 19276572
NCBI-ProteinID: XP_007838331
UniProt: W3WSN9
LinkDB All DBs
Position
Unknown
AA seq 999 aa AA seqDB search
MRKQKGEKVDERVITSIGSRNTNGRKLISKDHPLTEATAQIITHGPISGSATDYPTPTLP
SSVNYAASVTPNVDDPSAPDAQKLCPGYTASNVAENHAGFRADLTLAGTPCNVYGNDIAD
LVLEVEYQNATRLNVRIYPKHLVPANHSQYILPEFLSPVGIVEAGSTSNNSDLVLEWSNE
PSFQFKVSRVSGGDVLFDTYGTVIVFEDQFLELITSMVPDYNIYGLPESIRPFRISNDYT
QTFWNQYPVMNDNPLDTNLHSVHPVYAETRYGNGSSKSHVVYGRNLHGQEWLMRPDRIIY
RTIGGSLDFYFFSGPTVNEALAQQQLGVIKTPVMQPYWALGFHQVRWGYRNWTILQEVVD
NYAAANIQLEGIWNDLDYLLQYRDFQNDENTYPLAEGKEFLDRLHANGQYWVPILDPNIY
APDPTNATDAYAPYERGAALQAFIRDGVDGFYYGDQWPGYSVWPDFLIPQSQEFWTNEFL
IFHEKLAYDGWWLDLSDLSSWCTGSCGTGNLAYQPVHAPFKLPGEPGEVSYEYPEGFEIT
NATEAASASAAAASQSAAFPSVADQATPTVGFTEPTPGVRNISYPPYVLNNTLTGHALEK
SAVAPYATHSDEFNTTEYEMHNLFGIQSSNASYNGLVAVFPGKRPFLISRSTSPGSGNIT
GHWGGDSNSKWGNMYLTIAQALTFSIAGVPYFGVETCGFNGNADMELCTRWMELSAFFPL
YRNHNSRPGNTIAQEAYVWATTAEGTRRAMDVRFKLLAYTYTLFWHAHTAGATVMRAVQW
EFPDDSSLRGVDNQFMIGPSILVTPVLEPLATTVRGVFPGVASGTRWYDWYNYTEVQAQP
GENKTIDAPLVHIPVFIRGGSIIASQKPGNTTKTTRTNPWSIIVALDHDQQATGNLYLDD
GLSLVQNATKEINLSFTKSTLSVAIAGDYSDESPLANITIAGWEGMLPGMSVSAGGSEVD
CSGASINLDANTLFVQNLSGILKNGPWMEDFSIHFGNGS
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcagaagggggaaaaagttgatgaaagagttattaccagcatcgggtcgaga
aatactaatgggcgcaaattgatctcaaaagaccatccactaacagaagcaacagctcaa
atcatcacacatggcccaatatccggttctgcaacagattaccccacgcccacactgccc
tcgtcggtgaattacgccgccagcgtcacgcccaatgtagatgatccctcggcccccgat
gcgcaaaagctatgccctggctataccgcgtccaatgtggcagagaaccacgccggattc
cgcgccgacctgaccctggcggggacgccatgcaatgtctacggcaacgacattgcggat
ctcgtcctcgaggttgagtaccaaaacgccacgcgcttgaatgtccggatctacccgaag
cacctcgtgcccgcaaaccactcgcagtacattctcccagagtttctcagccccgtgggc
atcgtggaggcgggttcgaccagcaataacagcgacctggtgctcgagtggagcaacgag
ccgtcctttcaattcaaggtatcacgagtgagcggtggcgatgtgctctttgacacctac
ggcaccgtcatagtgtttgaggaccagtttcttgaactcatcacgtccatggtccccgac
tacaatatttacggactgccagaaagtattcgcccctttcgcatcagcaatgactacacc
cagaccttttggaaccagtatcccgtcatgaatgataatccgctcgacacgaacctccac
agtgtgcatccggtatacgctgagacccgttacggcaatggcagctccaagtcgcacgtg
gtctatggccgaaatctccacggtcaagagtggttgatgcggcctgatagaatcatctat
cgcaccattggcgggagtttggatttctacttctttagcggtccgaccgtgaacgaggcg
ctcgcgcaacagcagctcggggtgatcaagaccccggtgatgcaaccatattgggctctt
ggttttcaccaggtgcgatggggatatcgcaattggaccatactccaagaagtagtggac
aattacgcagcagccaatatccagctcgaaggcatctggaatgatttggattatctactt
cagtatcgcgatttccagaatgatgaaaacacgtacccgctcgccgagggtaaagagttt
ctggaccgcctccacgcgaatggccaatattgggtgcccatcctggatcccaatatttat
gcgcccgacccgacgaacgcgacagatgcgtatgccccctatgagcgaggcgcagcgctt
caagctttcatacgcgacggtgtggacggcttttactacggggatcaatggcctggctat
agtgtttggcccgactttctgattccgcagtctcaagaattctggacaaacgagttcctc
attttccacgaaaagttggcctatgacggatggtggctggatctttccgatctttcgtct
tggtgtactggatcttgcgggacgggtaatctggcgtatcagcctgttcacgccccgttc
aaactgccaggtgaaccaggcgaagtgtcctacgagtaccccgagggattcgagattacc
aacgctaccgaagcagcatcagccagcgcggcggcagcctcgcagtcggctgcatttcct
tccgtggcagatcaggctacacccactgtaggcttcaccgagccaacgccgggggtgcgc
aatattagttatccgccctatgtcctgaacaataccttgactggacacgccctggaaaaa
tcagctgtagcgccctacgcgacgcatagtgatgaattcaacaccaccgaatatgagatg
cataatcttttcggtatacagagctccaacgcctcgtacaacggcctagtcgcagtattc
cctgggaaaagaccattcctgatttcccggtccacctctcccggcagtggaaacatcacg
ggccactggggcggcgactcgaattccaagtggggcaacatgtacttgaccattgcccag
gctctaacctttagcattgcaggcgtgccctatttcggcgtcgaaacctgtggcttcaac
ggcaatgccgacatggagctatgtacacgctggatggaactgagtgcctttttcccgctg
taccgaaaccacaactctcggccaggcaacaccattgcgcaggaggcgtacgtgtgggca
accacggcagaagggacgcggcgagccatggacgtgcgcttcaagctgcttgcctatacg
tacacgctgttctggcacgcacacacggccggcgcgacggtgatgcgggcggtgcagtgg
gagtttcccgacgacagtagtctgaggggtgtggacaaccagttcatgatcggccctagc
attctcgtcacgccggttttggaacccctagccacgacggtccgtggcgtcttcccgggc
gtggctagcggaacgaggtggtatgactggtataattataccgaggtgcaagctcagccc
ggagagaacaagacgattgatgcaccactcgtgcatatacccgtcttcatcaggggtggt
agcatcatcgcttcccagaaacccggcaacaccaccaagacgacgcgcaccaatccatgg
agtatcattgtggcgctggaccacgaccaacaggcgacgggaaacttgtacctcgacgac
gggctcagtctcgttcagaatgccaccaaggaaattaatctctcctttaccaaatcgacg
ctatctgttgccatcgcaggtgattattcagatgagagtccactcgcaaatatcacaatt
gcgggatgggagggaatgctccccggtatgagcgtatcggcgggagggagtgaagttgat
tgcagcggagctagcatcaacctagacgcgaacaccctttttgttcaaaatctctcaggt
atcctgaagaatggcccctggatggaagatttctcaatccattttgggaacggctcgtga

DBGET integrated database retrieval system