KEGG   Pestalotiopsis fici: PFICI_11933Help
Entry
PFICI_11933       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
Organism
pfy  Pestalotiopsis fici
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C ADH_zinc_N_2 AIRS NADH_4Fe-4S Shikimate_DH NAD_binding_7 Sacchrp_dh_NADP Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 19276946
NCBI-ProteinID: XP_007838705
UniProt: W3WUK2
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MRAVRYYGPQDIRLEVNLPEPECLPHQVKVRPHFCGLCGSDLNAYKSPRAIPLKDTPHPI
TNEKWPVTLGHEFSGEVVEIGSEVRGGLEPGDRVAVQPTICCGHCVPCRSGSTNLCDSFG
FVGLTGWGGGLSDLVSVDARFVFKLPNSFPSDIGALVEPLAVAWHAIEQSGIKSGDNVLV
MGAGPIGLAVIQCLQAFQPKQVIVVEVARNRKEVARRLGVTAIIDPNEEDVVTKARLLCD
TQGPDVAFNCASVPSSIKAACEAVRKKGTIVNVAVWDSDIPINLNTLMFGEKKLFSALSY
TTTDFENVIKLFENNGLPKVGEMITRKITMDRVVEDGILALIHETDKHVKILIDVTA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgttcgttattacgggccccaagacatccgcctggaggtcaatctccccgag
ccggaatgtcttccccaccaggtcaaagtccgaccacacttttgcgggctttgcggctca
gacctgaacgcgtacaaatcacctcgagccatcccgctcaaagacacaccccacccgatc
accaatgagaagtggccagtcacactaggccacgagttctctggggaggttgtcgagatc
ggctcggaagtgcgcggtgggcttgagccgggcgacagggttgccgtacaacctacaatc
tgctgcggtcactgcgtcccgtgtcggagcggctcgacaaacttgtgtgactccttcggc
tttgtaggtttgacgggctggggcggggggctatcagacttggtgagcgtcgacgccagg
tttgttttcaaactgcccaactcgttcccgtcggatataggagctttggtcgagccattg
gccgtcgcttggcatgcgattgaacagagtggcatcaagtcgggtgacaatgttcttgtc
atgggcgcaggtccaatcgggttggccgtcatacaatgcttacaagcctttcagccaaaa
caagtcattgttgtcgaagtcgcccgcaatcgcaaggaggttgcgcgtcggctcggggtt
acggccattattgaccccaacgaagaggatgtagtcaccaaggctaggctcctgtgcgac
acccaaggtcctgatgttgctttcaactgcgccagtgtgccttcaagcatcaaggccgca
tgcgaggccgtacgcaaaaagggaacaatcgtcaatgtcgctgtctgggacagtgacatt
ccgattaatctgaacactttaatgtttggagagaagaagctcttttcagctctgagctat
actacgacagactttgaaaatgtgatcaagttatttgaaaataatggactacccaaagtc
ggagagatgattacccgtaaaatcaccatggatcgagtggttgaagatggtatcttggcg
ctcatccatgagacggataaacacgtcaagatacttatcgatgtcaccgcgtga

DBGET integrated database retrieval system