KEGG   Pestalotiopsis fici: PFICI_11937Help
Entry
PFICI_11937       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K22993  bifunctional Delta-12/omega-3 fatty acid desaturase [EC:1.14.19.6 1.14.19.-]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy01040  Biosynthesis of unsaturated fatty acids
pfy01100  Metabolic pathways
pfy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PFICI_11937
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.6  acyl-CoA (9+3)-desaturase
     PFICI_11937
    1.14.19.-  
     PFICI_11937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF3474
Motif
Other DBs
NCBI-GeneID: 19276950
NCBI-ProteinID: XP_007838709
UniProt: W3WRQ6
LinkDB All DBs
Position
Unknown
AA seq 436 aa AA seqDB search
MKHWVAETIHGDKVKAGSLETTLDGKPITLDVQQLRNQIPKHCLKPSLARSFGYVVHDLT
IFFIILMLTLHLEARLAHEHPVYRNMVCYILFPILAGLPLTGLWVLGHECGHGAFSTNKF
ISGVVGWTIHSALMNPYFSWRSSHGRHHQYANNISTDLNYVPPVRDEYAELFRGKIDLDR
LAEDAPVVVLLRIVMQQIIGWPWYLLTHITAGPNSAPKKSRGWWDNSHFLPNSSLFRSNE
FWYIVASDVGIILMSGAIYSLALNYGLETVVWAYFIPLAWVNHWIVMITYLHHTSPNLPK
YTPQAWTYLRGALATVDRDPGWLLRHAFHHIVDLHVIHHLFPRIPHYHAQEATEAIKPLL
QGHYHVDQSSYFGALWTAFTRCQWVEADADQTAKSPMYAGLDAHGDKGLQNVTSVDEKGV
LWYRPGPMPPPAVTMR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaagcactgggtggcagagaccattcatggtgacaaggtcaaggctggtagcctggag
acgactcttgacgggaagcccattacactcgacgtccaacagcttcgtaaccagatcccc
aagcactgtctcaagccttccttggctcgttcttttggttatgttgtgcatgacttgacc
atattcttcattatactgatgctcacactccatcttgaagcgaggcttgctcatgaacat
cctgtttatcgcaacatggtttgctatattctcttcccaatcttggctggtcttcctctt
accggcctatgggtactcggccacgagtgtggacatggagccttttcgacaaataagttc
atttcaggcgtggtcggttggaccattcactctgctctcatgaacccttacttctcctgg
cggtccagtcatgggcgtcatcatcagtatgcaaacaacatctcgacagacctcaactat
gtcccacctgtgcgcgatgagtatgctgagctgtttcggggcaaaattgacttggatcgc
cttgccgaggacgccccggtagttgtgcttctgaggattgtgatgcagcagatcatcggc
tggccatggtacctgcttacacacataacagctgggcccaactcggcgcccaaaaagtct
cggggttggtgggacaatagccacttcctacccaatagctccctgtttcgctccaatgag
ttctggtacatcgtcgcttctgatgtgggcatcattctcatgtcgggggccatatatagt
ctggcgctgaactatggactagagacagtcgtgtgggcatactttattcctctcgcatgg
gtgaaccactggatcgtcatgatcacttatcttcatcatacttcgccaaatctccccaaa
tacacgccgcaggcctggacatatctccgcggcgcactcgccacggttgatcgggaccct
ggatggctactgcggcatgcctttcaccatatcgtggatctgcacgtgatccatcatctt
ttcccgcgcataccacattatcatgcgcaggaagcgacggaagctatcaagcctctactc
cagggccactatcacgttgaccaaagctcgtattttggtgctctctggacggcatttacg
cggtgtcaatgggttgaggcggatgccgatcagacggcaaagtctccaatgtatgctgga
ctagatgcgcatggcgacaaaggcctccagaacgtcacgtctgtggatgaaaagggcgtg
ctctggtatcgcccaggacctatgcctccgcctgccgtgacgatgcgatga

DBGET integrated database retrieval system