KEGG   Pestalotiopsis fici: PFICI_12399Help
Entry
PFICI_12399       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00250  Alanine, aspartate and glutamate metabolism
pfy00410  beta-Alanine metabolism
pfy00430  Taurine and hypotaurine metabolism
pfy00650  Butanoate metabolism
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
Module
pfy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PFICI_12399
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFICI_12399
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFICI_12399
   00430 Taurine and hypotaurine metabolism
    PFICI_12399
Enzymes [BR:pfy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PFICI_12399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Glyco_transf_20
Motif
Other DBs
NCBI-GeneID: 19277412
NCBI-ProteinID: XP_007839171
UniProt: W3WNG6
LinkDB All DBs
Position
Unknown
AA seq 528 aa AA seqDB search
MPQTDTSLHGINGQINGLNGTTKHDAAGTTLNRASELEDANAVKGLLISYIRAADEAAPV
RAQGGDASAQASVLVEPHAPKALVEKMAFSLPQQSGKGKDGLLETIKDVLKYSVNTWDQG
FLDKLYSSTNPVGVISELVLSILNTNVHVYTVAPALTVIERETARSFARLFGFTGPRAGG
VTCQGGSSSNLTSLIIARNALYPDTKTNGNGSHNFVLFTSKHGHYSVEKAATTLGLGSAA
VIPIPVDDAGCMVPSSLREAIVKSKSEGKTPLYVNSTAGTTVLGSYDPFRAIAAICKEFN
LWLHVDGSWGGNAIFSSTQRHKLDGAELANSLTVNPHKMLNVPVTCSFLLTNDVGVFKKA
NTLAAGYLFHGGGGGDDDADNEEQHWDLADLTLQCGRRGDALKLALAWVYYGAAGFEEQV
DHAFAMASYLANLVNEHPDFVLMSSNPPPCLQVCFYYAPGGKLADENSENTRRTSELVKK
LVPRGFMVDYAPGPHGSFFRVVVNCQTLKGTVEGLLKALEEVGKQVVA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaaccgacacaagcctgcacggcatcaatggccagatcaacggtttgaatggt
acaacgaagcatgatgctgcaggaaccacattaaacagagcctctgagcttgaagatgca
aatgctgtgaaaggcctcttgatctcatatatccgcgcagccgatgaggcagctcccgtc
agagcccaaggtggcgatgcatcggctcaagcaagtgtgctcgtcgagccacacgcaccc
aaggcattggtagagaaaatggcattttccttgccgcagcagagtggcaaaggcaaagac
gggctccttgagactattaaagatgtcttgaagtatagcgtaaacacttgggaccagggc
ttccttgacaaactatactccagcacaaatcctgtgggagtaatctccgagcttgttctg
tcgattttgaatacgaatgttcatgtgtatactgttgctccggctttgactgtcattgag
cgagaaactgcacggtcatttgcccggctctttggcttcactggtccccgcgctggtgga
gttacatgtcaaggtggttcctcctcgaatctcacatcattgattattgcgcggaacgcc
ctctatcccgataccaagaccaacggcaacgggtctcacaactttgtgctctttaccagc
aagcacgggcattactcggtcgaaaaggccgccaccactctcggcctgggttccgcggcc
gtgattcccattcccgtggacgacgctggctgcatggtcccgagctcgttgagagaagct
attgtcaagtccaaatccgaaggcaagacgcctctctacgtcaactctacggccggaacc
accgtcctcggttcctacgatcccttccgcgccattgccgcaatttgtaaagagttcaat
ctctggctccacgttgatggttcgtggggcggaaacgccatcttctcgagcacgcagcgc
cacaagctggatggggcagagctcgccaattctctgaccgtgaacccgcacaagatgctc
aatgtgccagtgacgtgttcgttcctcctgaccaatgacgttggcgtcttcaaaaaggcc
aacaccctggcggcgggctacctgttccacggcggcggcggcggcgacgacgacgcagac
aacgaggagcagcactgggacctggccgatctgaccctgcagtgcggtcggcgcggcgac
gccctcaagctcgcgctggcttgggtgtactacggtgccgctggctttgaggagcaggtg
gaccacgcgttcgccatggcctcgtacctcgccaacctggtcaatgagcaccccgacttt
gtgctcatgagcagcaacccgccgccctgcctgcaagtgtgtttctattatgcccccggg
ggcaagctggccgatgagaacagcgaaaacactagacggacaagcgagctagtgaagaag
ctggtcccccgaggcttcatggtggactatgcgccgggcccgcatggcagctttttcagg
gttgtcgtgaactgtcaaacactaaagggaacagtcgaagggttgctcaaggcattagaa
gaagtaggcaagcaggttgtagcgtaa

DBGET integrated database retrieval system