KEGG   Pestalotiopsis fici: PFICI_13097Help
Entry
PFICI_13097       CDS       T04924                                 

Definition
(RefSeq) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00020  Citrate cycle (TCA cycle)
pfy00480  Glutathione metabolism
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
pfy01200  Carbon metabolism
pfy01210  2-Oxocarboxylic acid metabolism
pfy01230  Biosynthesis of amino acids
pfy04146  Peroxisome
Module
pfy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFICI_13097
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PFICI_13097
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PFICI_13097
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PFICI_13097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19278110
NCBI-ProteinID: XP_007839869
UniProt: W3WL61
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
MNSFYAAAARSIRPTTTSFARSAARPAAFRPVLSSAARPAVPVASFHYTRQAMAAQKIKV
KNPVVELDGDEMTRVIWQDIKDKFIHPYLDIDLKYYDLGLPYRDETNDQVTIDAAEAIKK
YSVGVKCATITPDEARVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVQGWKK
PIIIGRHAFGDQYRAKDKVIPGPGKLSMVYTPEGGQPEEIEVFQFKSGGGVAQTQYNTDE
SITGFAHASFKLALAKELPLYMSTKNTILKKYDGRFKDIFQEIYDTTYKADFEAKKIWYE
HRLIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEA
AHGTVTRHFREHQKGKETSTNPIASIFAWTRGLIQRGKLDDTPEVVAFAESLEQACIDTV
DVDGIMTKDLALACGKTAREDYVTTTEYLNAVERRMKSLLKEKL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttctacgctgccgccgctcgttcgatccggccgaccacgacttcctttgcc
agatctgccgcccggcccgccgccttccgtcccgtcctgagttctgccgcccgtcctgca
gtccccgtcgcctccttccactacaccagacaagccatggcggcccagaagatcaaggtc
aagaaccccgtcgtggagctcgacggtgatgagatgacccgtgtcatctggcaggacatc
aaggacaagttcatccacccttacctcgacattgacctcaagtactacgacttgggtctt
ccttaccgtgacgagaccaacgaccaggtcaccatcgatgctgccgaggctatcaagaag
tactcggtcggtgtcaagtgtgccaccatcactcccgacgaggcgcgtgtagaggagttt
aagctcaagcagatgtggctgtcccctaacggtaccatccgtaacgctctcggcggtacc
gtcttccgcgagcctatcgtgatcccgcgcattcctcgtttggtacagggatggaagaag
cccatcatcattggccgtcacgctttcggtgaccagtaccgggccaaggacaaggtcatc
ccgggccccggcaagctgtctatggtctacacccccgagggtggccagcccgaggagatt
gaggtcttccagttcaagagcggcggcggtgtcgcccagactcagtacaacactgacgag
agcatcactggtttcgcccacgccagtttcaagcttgctctggccaaggagctgcccctg
tacatgtccaccaagaacaccattctcaagaagtacgatggccgtttcaaggacatcttc
caggagatctacgacacgacctacaaggccgactttgaggccaagaagatctggtacgag
caccgcctgatcgacgacatggtcgctcagatgatcaagagctctggtggctacattatg
gcattgaagaactacgacggtgatgtccagtccgacattgttgcccaaggttttggttcc
ctcggtctcatgacttcggttctcatcacccccgatggcaagacctttgagtccgaggcc
gcccacggaaccgttacccgccacttccgcgagcaccagaagggcaaggagacctctacc
aaccccattgcctccatctttgcctggacccgcggtctgatccagcgtggaaagctcgac
gatacccccgaggtcgtcgcctttgccgagtccctcgagcaggcttgcattgacactgtc
gacgttgacggcatcatgaccaaggatctggccctggcctgcggaaagacggctcgtgag
gactacgtcaccaccaccgagtacttgaacgctgtcgagaggaggatgaagagcctgctc
aaggagaagttgtaa

DBGET integrated database retrieval system