KEGG   Pestalotiopsis fici: PFICI_13144Help
Entry
PFICI_13144       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PFICI_13144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfy02000]
    PFICI_13144
Enzymes [BR:pfy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PFICI_13144
Transporters [BR:pfy02000]
 Other Transporters
  Pores ion channels [TC:1]
   PFICI_13144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 19278157
NCBI-ProteinID: XP_007839916
UniProt: W3WL70
LinkDB All DBs
Position
Unknown
AA seq 214 aa AA seqDB search
MSTINPITVYVHTGGPNPWKVTIILEELGLPYTKIVVDNPKEDWFTAINPNGRLPAMIDP
NKELTLWESGAIVEYLVETYDKEQKLFVDDFATKWHLRQFLHFQMSGQGPYYGQAVWFQK
CPEDVPMAKRRYIEQSVRVVEVLDKMLEGKEYLAANRLTYADLSFVPWNHVLLSAPFFRE
ALWDKYDLAKKCPNFIAWHERLMARPSVKAVYGL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaataaaccccatcacggtctatgttcacaccggtggaccgaatccctggaaa
gtcaccatcatactggaggagcttggtctgccgtataccaagatagtcgtagataaccca
aaggaagattggttcacggccatcaacccaaatggtcgcctgccagccatgattgaccca
aacaaggaactcaccctctgggagtcgggggccatagtcgaatacctggtcgagacctac
gacaaggagcaaaaactcttcgtcgacgactttgccacgaaatggcacctgagacaattt
cttcactttcaaatgtctggccagggtccatactatggccaagctgtctggttccaaaag
tgccccgaggatgttcccatggcgaagcggcgatatattgaacaatcagttcgcgtcgtc
gaggtgcttgacaagatgcttgagggaaaagagtatctggctgccaacagactgacatat
gccgatctgtctttcgttccttggaaccatgttctactgagtgcaccattcttccgcgaa
gcactatgggataaatatgacctggccaagaaatgtccaaactttatcgcttggcatgag
agactcatggctcggccatccgtgaaggctgtgtatggtctataa

DBGET integrated database retrieval system