KEGG   Pestalotiopsis fici: PFICI_13756Help
Entry
PFICI_13756       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
Organism
pfy  Pestalotiopsis fici
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP NAD_binding_3 ADH_N_assoc NAD_binding_9 Lyase_1
Motif
Other DBs
NCBI-GeneID: 19278769
NCBI-ProteinID: XP_007840528
UniProt: W3WIY3
LinkDB All DBs
Position
Unknown
AA seq 402 aa AA seqDB search
MRALRYYGKGDIRLEQVEEPRVRPGWVKVKPAFVGICGTDLHEYLGGNNLIPKPGHPHPI
TQETSPVTLGHEFSGFVEETGDGITDLHQGERVCVQPTIYCNDCDSCKRNMHNACTRNGF
IGLSGWGGGLADYIAVPRSAVWKLPENVSLEFGGKFYSSSKWCLWLLTNPALVEPLAVGF
HAVSIAPVIHPIPAGTALLVLGGGPIGLSVIQAILAQADSSDDPPLIVVSEPSKARQNFA
REFGAQHVVDPLRQDLVTEVQKLTGGRGCDVVLDAAGVQSGLDEAMQCLRAGGTVVNIAV
WEKRATLEMNQLTFRERAYIGCATYNNQDFGHVLQAMASGRIRPGAMITRMIDIEDIEDK
GFRALIEEKDTQVKIMVDMGRIRRKDSAVVVSGEGGGREVVV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagagcattgcgatactatggaaaaggagatatccgactcgaacaggtcgaggagcct
agagttcgtccaggctgggtcaaggtcaagccagcgtttgttggcatctgcgggacagat
ttacatgaatatcttggaggaaataatttgatacccaagcctggtcaccctcatcccatc
actcaagaaacctccccggtgactctgggccatgaatttagtggatttgtggaggaaaca
ggtgatggaatcacagacttgcatcagggcgagagagtctgtgtacagccgacgatatac
tgcaatgattgtgattcctgcaaaagaaacatgcacaacgcctgcaccaggaatgggttc
atcggactcagcggctggggcggtggtcttgctgattacattgccgtcccaagatcggca
gtctggaaactccccgaaaatgtgtctcttgaatttggaggcaagttttattcatcatca
aagtggtgcctatggctgctaacgaacccagccctcgtcgaaccactagcagtcggattc
cacgccgtcagcattgctccagttatacatccaattccagctggtacagcgcttcttgtc
ctgggtggtgggccaattggactttcagtgattcaagccatcctcgctcaagcagactca
tcagatgaccctccactgattgtcgtgtcggagccatccaaagcccggcagaattttgca
cgtgaatttggagcccagcacgttgtcgatccgctaaggcaagatcttgttacagaggtt
cagaagctgacaggcggacgtggatgcgatgtggtcctcgacgcggcgggcgtccagtcg
ggattggacgaggcaatgcaatgtctgcgggcgggaggtaccgttgtcaacatagcagtc
tgggagaagcgagcgacgttggaaatgaaccagctgacgtttagggagagggcttacatt
ggatgcgcaacctataacaatcaggactttggccatgttctgcaagccatggcaagtggc
aggatccgcccgggtgcgatgattacacgaatgattgacattgaagacattgaggacaaa
ggattccgagcattgatcgaggaaaaggacacacaggtaaagattatggtcgatatggga
agaattaggcgcaaagatagcgccgttgttgtttctggcgagggtggggggcgtgaggtt
gtcgtgtaa

DBGET integrated database retrieval system