KEGG   Pestalotiopsis fici: PFICI_14951Help
Entry
PFICI_14951       CDS       T04924                                 

Definition
(RefSeq) Glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00500  Starch and sucrose metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFICI_14951
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PFICI_14951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19279964
NCBI-ProteinID: XP_007841723
UniProt: W3WKK6
LinkDB All DBs
Position
Unknown
AA seq 651 aa AA seqDB search
MHALSSLLLLGGYAAQAVFGRPDPEAARFKRKSDVLKRDVDSFIATEEPIAYAQILCNVG
PSGCHASGVGSGLVLASPSQSNPDYYYHWTRDAALTFKALIDRFVENYDADLQTEITNYI
TGQAQLQTVSNPSGSLSDGSGLGEPKFNTDFSAFTGAWGRPQRDGPALRATALITYGKWL
VNNGYTSTATSVVWPIIRNDLHYVAQYWNQTGFDLWEEVQGSSFFTIAAQHRALVEGSNF
AALVGDSCSYCDAIAPQILCFQQSFWTSGGYINSNINVNNGRTGKDANSVLSSNSGFDPS
LGCDANSFQPCSDRALSNHKLFVDSFRSIYTINSGKAAGTAAACGRYAEDSYYNGNPWYL
NTLAAAEQLYNALYVWDQQGSITVTSVSLNFFKDLSSSVAAGTYASGSSTYTTLYNAVLA
YADGFVDNVATYAMSNGSLAEQYDRNTGVPLSARDLTWSYAALLTAAARRAGTVPGSWAD
SNKLATSIPSSCYATSIGGSYSAATPASFPAGQTPSGGSGTTTVKPTTTTKTTTSTSTTT
TATSCATATNIAVTFNVLKTTTYGDTVKVVGSISALGSWAPASAIALSASSYTSSNPLWK
GTVTLAAGQTISYKYIVVSSSGTVTWESDPNRSLTITASCAGTQTVSDTWR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccctaagttcccttcttctcctaggcggctatgctgctcaggctgtctttggc
cgtccggatcccgaggcggcccgtttcaagcgcaagtccgatgtactgaagagagatgtt
gatagcttcattgctaccgaagagccaatcgcatacgcacaaatcctgtgcaatgttggt
cccagcgggtgtcacgcctctggagttggttccggcctcgtcctcgcgtctccttcccag
tctaatcctgattactactatcattggacaagagatgctgctttgacattcaaggctctt
attgacagatttgtcgagaactatgatgccgatcttcaaaccgagattaccaactacatt
actgggcaggctcaactccagacagtttcgaacccgtctggttctctgtcagatggctcc
ggcctgggtgaacccaagttcaacacagacttcagtgcattcactggggcatggggacgt
ccgcaacgagacggcccagcacttcgtgccactgccctaatcacttatggcaagtggctt
gtcaacaacggatacacgtcaaccgctaccagcgtcgtttggcccatcatccgtaacgat
ctccactatgttgcgcagtactggaaccagaccggttttgacctctgggaagaagtacaa
ggaagctctttcttcaccatcgccgctcagcacagagctttggtcgagggcagcaacttt
gccgctctcgtgggcgactcttgctcctactgtgatgccattgcgccgcagattctctgc
ttccagcaatccttctggacatctggcggctacatcaactccaacatcaatgttaacaat
ggcagaacaggcaaagacgccaattctgtattgagctccaactcgggttttgaccccagc
ctcggttgtgatgccaattcattccagccctgcagtgacagagccctgtccaaccacaag
ctatttgtggattcattccgctccatctacaccatcaactctggaaaggccgctggaaca
gctgctgcctgtggacgttatgccgaggacagctattacaatggcaacccatggtatttg
aacaccctcgctgcagccgagcaactctacaatgccctctatgtgtgggaccagcaaggc
tcgatcactgttacctcggtctcgctcaacttcttcaaggatctttcctcctcggtcgct
gctggcacctatgcttctggctcgagcacttacacgactctctacaatgctgtcctcgca
tatgccgatggcttcgtcgacaatgttgctacatatgcgatgagcaacgggtcactggcg
gagcaatatgaccgaaacacgggtgttcccttgtcagcccgggacttgacttggtcgtat
gccgcgctcctcactgccgccgcccgtcgtgccggcaccgtcccgggtagctgggccgat
tctaacaagctcgcaacatcgatcccaagctcttgctatgctacttccattggtggtagc
tattctgccgccactccagcttcgttccctgctggtcaaacacccagcggcggctctggc
accacaaccgttaagcccacgaccactaccaagaccaccacatctacgtcgacgaccaca
acggcgacatcctgtgccacggcgaccaatatcgcagtcactttcaacgtcttgaagaca
accacctatggagacaccgtcaaggttgttggtagcatctcggcactcggcagctgggca
ccggcttcggccattgctctttcggcctcttcgtacacatcgtccaacccgctctggaag
ggtactgtcaccctcgctgccggccagaccatctcgtacaagtacattgtagtcagcagc
agcggaaccgtgacttgggagtctgaccccaaccgcagcttgaccatcacggccagctgt
gcaggcacgcagaccgtgtcagacacgtggcgatga

DBGET integrated database retrieval system