KEGG   Pseudomonas fragi: AV641_11530Help
Entry
AV641_11530       CDS       T04285                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfz  Pseudomonas fragi
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AV641_11530
Enzymes [BR:pfz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AV641_11530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AMB79653
UniProt: A0A0X8EXQ0
LinkDB All DBs
Position
2555162..2556715
Genome map
AA seq 517 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSREMHDLLKEIASLSSMITLLDNGTDAR
KPSFSLNRPGGDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASPEVIEQIRALKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVTERQVMAVPSVYLNGVNF
GQGRMGLEEILGKLDTGAIERQAEKISAKEAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRADKLLPGKAGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQEYRSRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDTKLRADAVLQRKLNSLPNVTVITNALTTEVTGDGQ
KVNGLRYKDRATDELHHVELEGIFVQIGLLPNTDWLKGTIELSPRGEIVVDARGETSIPG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctaaaagcacagttgaagtcatacctggagcgggttacccagccg
atcgagatcgttgcttccctcgacgacggtgcgaaatcccgtgaaatgcatgacttgttg
aaagaaatcgccagcctttccagcatgattaccttgctggacaacggtaccgatgcgcgc
aagccttcgttttcgttgaaccgcccgggcggcgatatcagcctgcgtttcgcaggcatc
ccaatgggccacgaatttacttcgctggtgctggccttgctacaagtcggcggccaccca
tcgaaagccagtcctgaagtgattgaacagatccgcgccctcaagggcgagttcaacttc
gagacttatttctcgctgtcatgccagaactgtccggatgtggtgcaggcgctgaacctg
atggctgtattgaacccgaacattcgccacgtggcgattgacggcgcgctgttccaggac
gaagtcaccgaacgtcaggtgatggcagttcccagtgtttacttgaacggcgtgaacttc
ggccagggccgtatgggtctggaagaaattctcggcaagctggacaccggcgccatcgag
cgtcaggccgaaaaaatcagcgccaaagaggcgtttgatgtgctggtcataggtggtggt
ccggccggcgcagcggctgccatttatgcggcacgtaaaggcattcgtaccggcgtcgcc
gctgaacgctttggcggccaggtgctggataccatggccatcgagaactttatctcggtg
caggaaactgaagggccaaaactggccaccgcccttgaagaacacgtcaagcaatacgac
gtcgacatcatgaacctgcagcgtgccgacaagctgctgccgggcaaggcgggcgagttg
catgaggtgaaatttgccagtggtgcctcgctgaaagccaagaccgtgattctggcaacc
ggtgcccgctggagagagatgaatgtacccggcgagcaggaataccgtagccgtggcgtc
gcttactgcccgcactgtgacggcccgctgttcaaaggcaagcgcgttgcagttatcggc
ggtggcaactcgggtgttgaagcggcaatcgacctggcgggtatcgtttctcacgtcacc
ctgcttgagttcgataccaaactgcgggccgatgcggtgttgcagcgcaagctcaacagc
ttgccgaacgtaaccgtgattaccaatgccctgaccaccgaagtcacaggcgacggtcag
aaggtcaatggtctgcgttacaaggatcgggccacagacgagttgcaccacgtcgagctg
gaagggatttttgtccagatcggcttgctgccgaacactgactggcttaaaggtacgatc
gagctttcacctcgcggcgagatcgtggttgatgcccgtggtgaaaccagcatccccggc
atctttgccgccggcgacgtcactaccgtgccatacaagcagatcgtgattgcggtgggc
gagggtgcgaaagcttcgctgagtgcttttgatcacctgatccgctcggaataa

DBGET integrated database retrieval system