KEGG   Pseudomonas fragi: AV641_12985Help
Entry
AV641_12985       CDS       T04285                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pfz  Pseudomonas fragi
Pathway
pfz00473  D-Alanine metabolism
pfz01100  Metabolic pathways
pfz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AV641_12985
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AV641_12985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfz01011]
    AV641_12985
Enzymes [BR:pfz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AV641_12985
Peptidoglycan biosynthesis and degradation proteins [BR:pfz01011]
 Precursor biosynthesis
  Racemase
   AV641_12985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a DUF1507 DUF5604
Motif
Other DBs
NCBI-ProteinID: AMB81803
UniProt: A0A0X8F0V2
LinkDB All DBs
Position
2865243..2866472
Genome map
AA seq 409 aa AA seqDB search
MPFTRTLLALSLGMALLQNPAFAAPPLTMTDGVAQVSTQDSNAWVEINKAAFENNIRVLQ
ATLDGKSKICAVLKADAYGHGIGLLMPSVIAMGVPCVGVASNEEARVVRESGFKGQLIRV
RTAALSELEAALPYNMEELVGNLDFAVRASLIAEQHGRPLVVHLGLNSSGMSRNGVEMTT
AQGRRDAVAITKVPNLEIRAIMTHFAVEDADDVRAGLKAFNQQAQWLMNVAGLDRSKITL
HAANSFATLEVPESHLDMVRPGGALFGDTVPSHTDYKRVMQFKSHVASVNSYPKGNTVGY
DRTYTLGRDSKLANITVGYSDGYRRAFTNKGIVLINGHRVPVVGKVSMNTLMVDVTDAPD
VKSGDEVVLFGQQGKAQISQAEVEDINGALLADLYTVWGNSNPKILIDQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcactcgcaccctgctcgccctctctctgggtatggctctgctgcaaaacccg
gccttcgccgccccgcccctgacgatgaccgatggtgtggcacaggtcagtactcaggac
agcaatgcctgggtcgaaatcaacaaggctgccttcgaaaacaatatccgggtgctgcaa
gccactctggatggcaagtcgaaaatctgcgccgtgctcaaggccgatgcctacggccac
ggtatcggtctgctgatgccgtcggtgattgccatgggcgttccctgtgtcggggttgcc
agcaacgaagaagcccgtgtggtgcgcgaaagcggcttcaagggccagttgatccgcgta
cgcaccgccgccctcagcgagctggaagcagcgctgccgtacaacatggaagaactggtg
ggcaacctcgacttcgcggtcagggccagcctgattgccgagcaacacggtcgcccgctg
gtggtccatctggggttgaactccagcggcatgagccgtaacggcgtggaaatgaccacc
gcccaggggcgccgtgacgcggtggccatcaccaaagtgccgaaccttgaaatacgggcg
atcatgacccacttcgccgtcgaggatgccgatgacgtgcgcgccgggctcaaggctttc
aaccagcaggcgcagtggctgatgaacgtcgccgggctcgatcgcagcaaaatcaccctg
cacgcggccaactcgttcgccaccctggaagtgccggagtcgcatctggacatggtccgc
cccggcggcgcgctgttcggtgacaccgtaccgtcccacacagattacaaacgggtgatg
caattcaagtcccacgtggcctcggtcaatagctaccccaagggcaataccgtcggttat
gaccgcacctacaccctgggtcgtgactcgaaactggccaacatcacagtcggttactcc
gacggttaccgtcgtgcgttcaccaacaaaggcattgtgctgatcaacggccaccgcgtg
ccggtggtgggcaaggtatcgatgaacacccttatggttgacgtcaccgatgccccggac
gtgaaaagcggtgatgaagtggtgctgttcggccaacagggcaaggcgcaaatcagccag
gcagaggtcgaagacatcaacggcgcgctgctggccgacctgtacaccgtatggggcaac
tccaacccgaagatcctgatcgaccaataa

DBGET integrated database retrieval system