KEGG   Pseudomonas fragi: AV641_14440Help
Entry
AV641_14440       CDS       T04285                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pfz  Pseudomonas fragi
Pathway
pfz00250  Alanine, aspartate and glutamate metabolism
pfz00410  beta-Alanine metabolism
pfz00430  Taurine and hypotaurine metabolism
pfz00650  Butanoate metabolism
pfz01100  Metabolic pathways
pfz01110  Biosynthesis of secondary metabolites
pfz01120  Microbial metabolism in diverse environments
pfz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AV641_14440
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AV641_14440
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AV641_14440
   00430 Taurine and hypotaurine metabolism
    AV641_14440
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AV641_14440
Enzymes [BR:pfz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AV641_14440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AMB80182
UniProt: A0A0X8EXS1
LinkDB All DBs
Position
complement(3239367..3240764)
Genome map
AA seq 465 aa AA seqDB search
MALHRIKHKSATDPVFGSSELAHAAVTKGFPEAEQSPRDVYQLVHDELYLDGNARQNLAT
FCQTWEEDEVHKLMDLSIDKNMIDKDEYPQSAELENRCIHMLADLWHSPAAATTLGTSTV
GSSEACMLSGLAALWRWRAVRKAAGKAATTPNMVCGPVQVCWHKFARYWDIEIREVPMSE
GHWFMRPEDMLERVDENTIVVVPTFGQTFTGLYETVKPLSDALDDLEKSSGLSVDLHVDG
ASGAMLAPFCAPDILWDFRVPRVKSISTSGHKFGLAPIGAGWVVWRDAKELPEGLIFHVN
YLGGDMPTFALNFSRPAGQIIAQYYNFLRLGREGYERIHSACYETAQFLARELVKIGPFE
MLYNGDPQLGIPALTWRLKPGAKTNYSLYDLADRLRVRGWLVPAYSLPANVEEVVVQRIL
VKQGMSIDMAKLLLADFVRDIQFFAEHQPHGFKGREAEAGNHAGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcaccgcatcaagcacaagtcggccacagatcccgtttttggttcttctgaa
ctggctcacgccgctgtgaccaagggcttcccggaggcggagcagtcgccacgagatgta
taccagttggtccacgatgagctgtacctggatggcaacgcccgccagaatctcgccact
ttttgccaaacatgggaagaggatgaagttcacaagctgatggacctgtcgatcgacaag
aacatgatcgacaaggacgaatatccgcaatcggcggaactggagaaccgttgcatccat
atgctggcggatctatggcattccccggcggcggccaccaccctcggcacttcaactgta
ggttccagtgaagcttgcatgcttagtggtctggctgcgttgtggcgctggcgtgcggtg
cgcaaagcggctggcaaggctgctactacgccgaatatggtgtgcggtccggtgcaggtt
tgttggcacaagtttgcccgttactgggatatagaaatccgtgaagtaccgatgtccgaa
gggcattggttcatgaggcctgaggacatgctggagcgggtcgatgaaaacaccatcgtg
gtggtgccgaccttcggccagacatttaccggtctgtatgaaaccgtaaaaccgttgtcc
gatgccctggacgatctggaaaaaagcagcggcctgagtgtcgaccttcacgtcgatggt
gcaagtggcgcgatgctggcgccgttttgcgcaccggacattctttgggactttcgtgta
ccgcgggtcaagtccatcagcacctccgggcacaagttcggcctggcaccgataggcgcg
ggttgggtggtttggcgcgatgcgaaggaactgccggaaggcctgatttttcatgtgaac
tacctgggcggcgacatgccgactttcgccctgaacttttcgcgcccggccgggcagatc
attgcccagtactacaacttcttgcgcctggggcgtgaggggtatgagcgtattcattca
gcgtgctacgaaacagcgcaatttttggcgcgagagctggtcaagatcgggccgttcgag
atgctctacaacggtgatccgcaattggggatcccggcgctgacctggcgtttgaagccg
ggggcgaaaaccaattactccctgtatgacctggcggaccgcctgcgcgtccgcggttgg
ctggtgccagcgtacagcttgcctgccaatgtagaagaggtggtggtgcagcggattctg
gtcaagcaggggatgtcgatcgacatggccaaattgttgctggccgactttgtgcgggat
attcaattcttcgctgagcatcagccccacggctttaaaggccgtgaagctgaagcggga
aatcatgccggacggtag

DBGET integrated database retrieval system