KEGG   Pseudomonas fragi: AV641_17380Help
Entry
AV641_17380       CDS       T04285                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
pfz  Pseudomonas fragi
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AV641_17380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AMB80710
UniProt: A0A0X8EYT4
LinkDB All DBs
Position
complement(3872368..3873321)
Genome map
AA seq 317 aa AA seqDB search
MLFPVLNGLPLGKVLIRTVKEFIDDEMSTYASALAYQMLFSLFPFILFLIALIGFLHLPD
FFSWLRLQSELVLPPQALEQVNPVIDQLQQSKGGLLSVGIVIALWTASAGVRLMMSAMNA
AYDVVEGRPVWKRFPLSIFYTIGIAGMLLAAAALMVLGPQVMSWLAGQVGLEEFVVTLWT
ILRWPVIVLLLMVAVAVIYYVMPDVEQKFRFITPGSVLAVVVWIVASLGFAFYVKTFADY
NAMYGSIGAIIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGKDPGEKTFDGSDDPDPKQH
VSGLGRDHSIPSTPDEA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgttattcccggtcttgaatggcctgccgttgggcaaagtactgattcgcacggtgaaa
gagtttatcgacgatgaaatgtcgacttacgcctcggcactggcctatcaaatgctgttt
tcgttattccctttcattctgtttttgattgccctgatcggcttcttgcatctgccggac
tttttctcctggttgcgcctgcagtctgaactggtactgccgccgcaggctctggagcag
gtcaacccggtcatcgatcagttgcagcagtccaagggcggattgctgtcggtgggtatc
gtaattgccctgtggaccgcttcggccggtgtgcggctgatgatgagcgccatgaatgcc
gcctacgatgtggtcgaggggcggccagtctggaagcgattccctctgtcgattttttac
accatcggcattgccggaatgcttctggcagccgccgcgctgatggtgctcgggccgcag
gtgatgagctggctggcaggacaggtcgggctcgaagagttcgtggtgacactgtggacc
atcctgcgctggcctgtgattgtgctattgctgatggtggcggtggcggtgatttactac
gtcatgccggatgtggagcaaaaattccggtttatcaccccgggttcggtgctggcggtg
gttgtgtggatcgtggcttcgctgggctttgccttttatgtcaaaacctttgctgactac
aacgccatgtatggcagcatcggtgcgatcatcgtgctgttgctgtacttctacatttct
gccgcggtgctgctgctgggggctgaaatgaacgccgtgatcgagcacatgtcggcagag
ggcaaggatccgggcgaaaaaaccttcgatggctccgacgaccctgatcccaagcaacac
gtctccgggctggggcgtgaccattccattccatccactccagatgaagcctga

DBGET integrated database retrieval system