KEGG   Phaeobacter inhibens DSM 17395: PGA1_78p00360Help
Entry
PGA1_78p00360     CDS       T02192                                 

Definition
(GenBank) putative ferrichrome transport ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
pga  Phaeobacter inhibens DSM 17395
Brite
KEGG Orthology (KO) [BR:pga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pga02000]
    PGA1_78p00360
Transporters [BR:pga02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    PGA1_78p00360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 SMC_N AAA_25 AAA_22 AAA_23 AAA_29 RsgA_GTPase AAA_30 AAA_15 AAA AAA_33 ABC_ATPase AAA_14 SRP54 Zeta_toxin Cytidylate_kin ATPase_2 AAA_18 NACHT Rad17 AAA_5 AAA_28 TsaE MMR_HSR1 RNA_helicase NTPase_1
Motif
Other DBs
NCBI-ProteinID: AFO93557
UniProt: I7F2Q8
LinkDB All DBs
Position
pPGA1_78:complement(43453..44211)
Genome map
AA seq 252 aa AA seqDB search
MIDVTGLSFTLGDKPILDTVDACLPAGQITALIGPNGAGKSTLLKLIAQQLTASWGRICL
SGCDLRSITPEQLARRMAVVGQQLDVASRVRVRDLVGFGRWPHSRGRLRAEDQAAIADAL
ALFELDDLRDRFLDELSGGQRQRAFIAMAYAQDTDWLLLDEPLNNLDLNHARNLMAQLRH
LADTRGKSIVIVLHDLNYAISWADHVVALAAGRVAFAGPVAEVATSESLSALYQTPVALR
EVEGRPIACYHG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgtgacgggcctgtcgttcacactgggtgacaaaccgattctggacacggtg
gatgcctgccttcccgcaggtcagatcacggcgctgatcggaccgaacggagccgggaag
tcgacgctgctgaagctgattgcgcagcagctgacggccagctgggggcggatctgcctg
tcgggatgtgatctgcgcagcatcacgccggagcagctggcgcgccgaatggcggtggtc
gggcagcagttggacgtcgcgagccgggtgcgggtgcgcgatctcgttggtttcggacgc
tggccgcacagccggggtcggctgcgggcagaggatcaggccgcaattgccgatgcgctg
gcgctgtttgagctggacgatctgcgcgacaggtttctggatgaactgtctggcggtcag
cggcaacgggcctttatcgcgatggcctatgcgcaggataccgactggttgctgttggat
gaaccgctcaacaatctcgatctcaaccacgcgcgcaatctgatggcgcagctgcggcat
ctcgccgatacgcgcggcaagagcatcgtgatcgtgctgcatgatctcaactatgcgatc
agctgggccgatcatgtcgtggccctcgctgctgggcgcgttgcctttgccggaccggtg
gcggaggtggcgacaagcgaaagcctcagcgcgctttatcagacgccggttgccctgcgc
gaggtcgaaggccgccccatcgcctgctatcacggctga

DBGET integrated database retrieval system