KEGG   Phaeobacter inhibens DSM 17395: PGA1_c08240Help
Entry
PGA1_c08240       CDS       T02192                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00564  Glycerophospholipid metabolism
pga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGA1_c08240 (glpD)
Enzymes [BR:pga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PGA1_c08240 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 NAD_binding_8 K_oxygenase Mqo FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFO90551
UniProt: I7DN66
LinkDB All DBs
Position
complement(852461..854050)
Genome map
AA seq 529 aa AA seqDB search
MSNTNAQDQITDLFIIGGGINGCGIARDAAGRGLSVALAEMNDLASATSSASTKLFHGGL
RYLEYFEFRLVREALIEREVLLKAMPHISWPMRFVLPFHKDMRFDNTTPTSKLLTTIMPW
MKGRRPAWLIRLGLFMYDSLGKRGILPGTSKLDLASDPAGRPLDPKFKTAFEYSDCWIED
ARLVVLNARDAEARGAEIMTRTKVTGATRNADHWVIDLEDITTGETSQRRAKMLVNAGGP
WVADVLRQKLGQNSRESVRLVRGSHIVVPKLYDHGRCYFFQGTDGRIIFAIPYEEDYTLI
GTTDADHPDPQTAPTCTPEEQDYLINFASQYFANPLSRDDIVWTYSGVRPLYDDGASSAT
AATREYVLTLNDSAAPLLNVFGGKITTYRKLAEAALEKIATVFPDLPADWTAGVALPGGD
FPVGDVAKLTAKLAQDYPFLSPYATRRLIRAYGTEAWEVLGKATTAADLGEAFGATVTAR
ELDWTIAHEWVRTGEDYLLRRTKLALRLTEAERAAVDSYIRSKAADLAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacacaaacgctcaagaccaaatcaccgatcttttcatcatcggcggcggcatc
aatggttgcggcatcgcccgcgacgccgcagggcggggcctgtccgtggcgctggctgag
atgaacgatcttgcctccgccacctcctccgcctcgaccaagctgtttcacggcggattg
cgctatcttgaatacttcgaattccggctggtgcgtgaggcgctgatcgaacgcgaggtg
ctgttgaaagcgatgccgcatatctcctggccaatgcgctttgtgctgccgtttcacaag
gacatgcgctttgacaacaccacgccgacgtcaaaactgctgaccaccatcatgccgtgg
atgaagggtcggcgtccggcctggctgatccgtcttggcctgttcatgtacgacagcctc
ggcaaacgcggcatccttcccggcacctccaaactggatctcgccagcgatcccgccggc
cgcccgctggatccgaagttcaagaccgcttttgaatattccgactgctggatcgaagac
gcacggctggtggtgctgaatgcccgcgacgccgaggcccgcggcgccgaaatcatgacc
cgcaccaaagtgaccggcgccacccgcaacgcggaccactgggtgattgaccttgaagac
atcaccacgggcgaaacctcgcagcgccgtgccaagatgctggtcaatgccggcggcccc
tgggtggcagatgtgctgcgtcagaagctgggccagaacagccgcgaaagcgtccgtctg
gtgcgcggcagccatatcgtggttccgaaactctatgatcacgggcgctgctactttttc
cagggcaccgatgggcgcatcatcttcgccattccctacgaggaagactacacgctgatc
ggcaccactgacgccgaccaccccgacccgcagaccgccccgacctgcacgcccgaggaa
caggattacctgatcaatttcgcctcgcagtatttcgccaacccgctcagccgtgacgat
atcgtctggacctattccggcgtgcgtccgctttatgacgatggcgccagctctgccacc
gccgccacccgcgaatatgtgctgaccctgaacgacagcgccgcgccgctgctgaatgtc
tttggcggcaagatcaccacctatcgcaaactggccgaggccgcgctggagaagatcgca
accgtgttccccgatctgcccgccgactggaccgcaggcgttgccctgcccggcggtgat
ttcccggtcggagacgtggcaaaactgaccgcgaaactggcgcaggactatccgttcctc
agcccctacgcgacccgtcgcctgatccgcgcctatgggacagaggcctgggaggtgctg
ggcaaagccaccacagccgccgatctcggcgaggccttcggcgccaccgtcaccgcccgt
gaacttgactggaccatcgcccacgaatgggtccgcaccggcgaggattacctgctgcgc
cgcaccaaactggccctgcgcctgaccgaggcagagcgcgccgccgtcgacagctacatc
cgcagcaaagccgcagacctggccgcctga

DBGET integrated database retrieval system