KEGG   Phaeobacter inhibens DSM 17395: PGA1_c09660Help
Entry
PGA1_c09660       CDS       T02192                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00473  D-Alanine metabolism
pga00550  Peptidoglycan biosynthesis
pga01100  Metabolic pathways
pga01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PGA1_c09660 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PGA1_c09660 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PGA1_c09660 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pga01011]
    PGA1_c09660 (ddl)
Enzymes [BR:pga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PGA1_c09660 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pga01011]
 Precursor biosynthesis
  Amino acid ligase
   PGA1_c09660 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AFO90685
UniProt: I7EXT3
LinkDB All DBs
Position
990243..991163
Genome map
AA seq 306 aa AA seqDB search
MSKSSRTLPKVAVLMGGPSAEREVSLSTGRECATALRDEGYQVTELDAGPDLAARLQADR
PDVVFNALHGRWGEDGCVQGLLEWLGIPYTHSGVLASALAMDKQRAKSIYRAAGLPVVES
GIYSKAEVMAGHVMAPPYVVKPNNEGSSVGVYLVNEVANGPPQLSQDMPDEVMVESFAPG
RELTTTVLGDKPLTVTDILTDGWYDYDAKYKPGGSRHVLPADVPEEIFALCLDYAVKAHD
ALGCRGISRTDFRWDEARGAEGLILLETNTQPGMTPTSLTPEQAEHSGMTFGQLCSWLVE
DATCPR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagtcgagcaggacactcccgaaagtggcggtattgatgggtggcccctcggct
gagcgcgaggtgtctttgtccactgggcgtgaatgcgccaccgcgctgcgggacgaggga
tatcaggttacggaactggacgcgggtccggatcttgctgcacgtttgcaggcggatcgt
ccggacgtggtcttcaatgcgctgcatggtcgttggggcgaagacggctgcgtgcagggg
ctgctggaatggctcggcatcccttacacccactccggcgtgctggcctcggcgctggcg
atggacaagcagcgcgccaaatccatctaccgcgccgcaggtctgcccgttgttgagagc
gggatttactccaaggctgaggtgatggcgggccacgtgatggcgccgccctatgtggtg
aagcccaacaacgaaggctccagcgtcggcgtctatctggtgaatgaggtggccaatggc
ccgccgcagctgtcgcaggatatgccggacgaggtgatggtcgaaagctttgcccctgga
cgcgagctgaccaccacggtgctgggtgacaagccgctgacggtaacggatatcctgacc
gacggctggtatgactacgacgcgaaatacaaacccggcggttcgcggcatgtgttgccg
gcagatgtccccgaagagatctttgcgctttgccttgactacgcggtgaaggcccatgat
gcgctggggtgccggggcatcagccggaccgatttccgctgggatgaggcgcggggcgcc
gaagggttgatcctgctggagaccaacacccagcctggcatgaccccgacatcgctgacg
ccggagcaggcggaacacagcggtatgaccttcgggcagctttgttcctggttggttgag
gatgcgacatgtcctcgctga

DBGET integrated database retrieval system