KEGG   Phaeobacter inhibens DSM 17395: PGA1_c24670Help
Entry
PGA1_c24670       CDS       T02192                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00240  Pyrimidine metabolism
pga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PGA1_c24670 (tdk)
Enzymes [BR:pga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PGA1_c24670 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AFO92151
UniProt: I7DSV0
LinkDB All DBs
Position
2574465..2575064
Genome map
AA seq 199 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQASHNYRENNMDTYLLTAALDDRAGQGRIASRIGIGAEAD
MFRPGENLYDKVSNRLAKGAVASIFVDEAQFLSPDQVWDLARVVDDLRVPVLCYGLRVDF
QGKLFPGSATLLALADEMREVRTICHCGKKATMVIRQDDQGRTITEGAQVQIGGNETYVS
LCRRHWRQATGDLPAEASD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttactttcattactccaccatgaatgccggcaaatcgacggtgctcttg
caagcctcgcataactaccgcgagaacaatatggacacctatctgctgactgcggcgttg
gatgaccgcgccggtcaggggcggattgcctcccgcatcgggatcggcgccgaggcggat
atgtttcgccccggcgagaacctgtatgacaaggtaagtaaccgtctagccaagggcgcg
gtcgccagtatctttgtcgatgaggcgcagtttctgtcaccggatcaggtctgggatctg
gcacgggtggtggatgatctgcgggtgccggtgctgtgctacgggctcagggtcgatttt
cagggcaagctgttcccgggatcggcgacgctgctggcgctggctgatgaaatgcgcgag
gtgcgcaccatctgccactgcggcaagaaggcaaccatggtgatccggcaggatgatcag
gggcggaccatcaccgaaggggcccaggtgcagatcggcggcaatgaaacatatgtgtcg
ctctgccgtcgccactggcgacaggccacgggcgacctgcctgcggaggcgtctgactga

DBGET integrated database retrieval system