KEGG   Photobacterium gaetbulicola: H744_1c0378Help
Entry
H744_1c0378       CDS       T03698                                 

Definition
(GenBank) carboxypeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H744_1c0378
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pgb01003]
    H744_1c0378
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pgb01011]
    H744_1c0378
Enzymes [BR:pgb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     H744_1c0378
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H744_1c0378
Glycosyltransferases [BR:pgb01003]
 Polysaccharide
  Bacterial polysaccharide
   H744_1c0378
Peptidoglycan biosynthesis and degradation proteins [BR:pgb01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   H744_1c0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AJR05403
UniProt: A0A0C5WE91
LinkDB All DBs
Position
1:451730..453916
Genome map
AA seq 728 aa AA seqDB search
MGMDINDEVTTKFEGQLWQLPSVVYARELSLQPGVLVRYEDLVNELEALKYRKVSKPTRP
GEYSTGRLTVEMIRRPFEFRDGQQEARHVVVKFDYSKVKSITEAESNRELGYIRVEPKML
GMLEAQTEEQRIYRPMDEMPQDLIDALIATEDRDFYQHDGISPTAIARAFIANLKAGRTV
QGGSTLTQQLAKNMFLTSERSLWRKAREAYMALIIDYRYSKDQILDAYLNQVYLAQSGRD
AVHGFELGSRFYFGLPLSELRVDQQALLVGLVKGPSYYNPWRYPERAKNRRNLVLQLMFE
NGVLEQDDYLAAAEKPLDIQAKGTISNRQPAYFGQLQRELAAKVKNYEAGRGLRLFTTLD
PRSQAMAEQSVRKVIPKLESKAGDQLETAVVIADRVSGEIRAMVGGSRPGYDGFNRAVDA
KRQIGSVVKPAVYLAALEMPKRFSLATSLQDRPLTLKGQNGENWSPRNYDRQYRGEVPLY
SALAKSYNIPTVNLGMAVGLDEVINTMEKLGIDKNEVPKLPSMLLGAFTLTPVEVTQMYQ
TIASGGHRTELSALGAVVDSEGNILYQSLPVSTQAVSLQAAWLTMYGLQRVVSEGTGRYL
NSLLPSSRLAGKTGTSDRGRDSWYVGVDGREVVTIWMGRDDNKAVKLTGSSGPLRLYADY
IQSRDPEPLVLQTPAQISDFDYYRDQHGVLSQSCVGQTHLPAWDPQGTLKQGCVRKVEYF
FKRLFQFN
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggatatcaatgatgaagtcaccactaagtttgaggggcaactgtggcagctt
ccttcggttgtttacgcgcgtgaactgtcgctacaaccgggtgtgctggttcgttatgaa
gacttggtcaatgaactagaagcgctgaaataccgcaaggtaagcaagccgacccgcccg
ggtgaatactcgacaggccgcttgacagttgaaatgatccgccgtccttttgagttccgt
gatggtcagcaggaagctcggcatgtggtggtcaaatttgactactctaaagtaaagtcg
atcactgaggctgagtctaaccgagagctgggttatatccgagttgagcccaagatgctt
ggcatgctagaagcacaaacagaagagcagcgtatctatcggccaatggatgaaatgcca
caagacttgattgatgcactgattgcaacagaagacagggacttctatcagcatgacggc
atttcgccaacggccattgcgagggcgtttatcgcaaacctcaaggctggccgcaccgtc
cagggggggagcacactgactcagcagttggccaagaatatgtttttgaccagtgagcgc
agtctgtggcgtaaagcgcgtgaagcctatatggcgctgattatcgactaccgttacagc
aaagatcagatcctcgatgcgtatttgaatcaggtgtatttggcacaaagtggccgagat
gcagtacatggttttgaattaggttcgcgtttctatttcggtttgccgctgtctgagttg
cgtgttgatcagcaagccctcttggttgggctcgttaaggggccatcttattacaaccct
tggcgatacccagagcgcgccaaaaaccgccgtaacttggtgttgcagttaatgtttgaa
aatggcgtgctggaacaggacgattatcttgcagctgcggaaaagccacttgatatccaa
gcgaaaggtacgatttcaaatcgtcagcctgcatatttcggtcagcttcagcgggaactg
gccgcgaaggtgaaaaactatgaagcggggcgggggctaaggctattcactacactggat
cctcgctcacaagcaatggctgaacagtcggttcgtaaggttattccgaagttagaatca
aaggcgggtgaccagcttgagactgccgttgttattgctgacagagtcagtggcgagatt
cgtgcgatggtgggcggctcccgcccgggatatgacggttttaaccgtgccgttgatgcc
aagcgccaaattggttcagtagtaaagcctgcggtttatttggccgctcttgagatgccg
aagcgtttttctctggcaaccagccttcaagacaggccgctgaccctgaagggccagaac
ggggagaattggtcgcctcgaaactatgacaggcagtaccggggcgaggtaccgctgtat
agcgccttagcgaagtcctataacatcccgacggtgaatctgggcatggctgtcggcctg
gatgaagtgatcaacaccatggaaaagctcggtattgataaaaatgaagtgccgaagctg
ccgtctatgctgctcggggcatttaccctgaccccggtagaagtgacccagatgtatcag
accattgccagtggcggccatcgaactgaactttcggcattgggagcggtggttgatagc
gaagggaatatactttatcaatccttgcctgtatcaacccaggctgtctcactacaggct
gcgtggttgaccatgtatggcctacaacgtgttgtaagcgaaggtaccgggcgttatctg
aattctttgctgccgtcttcgcgtttggccggcaaaaccggtacttccgacagaggacga
gatagctggtatgtcggtgtcgatggccgtgaagtggtaaccatatggatggggcgcgat
gataacaaggccgttaagcttaccggctcgtcaggcccgctccgtttgtatgcagactat
atccaaagccgcgatccggaacctctggtcttacagaccccggctcaaattagtgacttt
gactattaccgtgatcaacacggtgttttatcgcaaagctgtgtcgggcaaacacaccta
cccgcctgggatcctcaagggacattgaagcaggggtgtgtgcgtaaagtagagtatttc
tttaagcgtttattccagttcaattaa

DBGET integrated database retrieval system