KEGG   Photobacterium gaetbulicola: H744_2c1255Help
Entry
H744_2c1255       CDS       T03698                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00020  Citrate cycle (TCA cycle)
pgb00190  Oxidative phosphorylation
pgb00650  Butanoate metabolism
pgb01100  Metabolic pathways
pgb01110  Biosynthesis of secondary metabolites
pgb01120  Microbial metabolism in diverse environments
pgb01130  Biosynthesis of antibiotics
pgb01200  Carbon metabolism
Module
pgb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pgb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H744_2c1255
   00650 Butanoate metabolism
    H744_2c1255
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H744_2c1255
Enzymes [BR:pgb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     H744_2c1255
    1.3.5.4  fumarate reductase (quinol)
     H744_2c1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like Thi4 DAO FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AJR07934
UniProt: A0A0C5WS66
LinkDB All DBs
Position
2:1311360..1313126
Genome map
AA seq 588 aa AA seqDB search
MSIAVREFDAVVIGAGGAGMRAALQISEQGLKCALLSKVFPTRSHTVSAQGGITVALGNS
HPDNWQWHMYDTVKGSDYIGDQDAIEYMCKNGPKSVIELEKMGLPFSRFDNGTIYQRPFG
GQSKEFGGEQAARTAAAADRTGHALLHTLYQQNVKHKTTIFSEWYALDLVKNQDGAILGC
TALCMETGEICYFKAKATILATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMVEIREG
RGCDGPWGPHIKLKMDHLGKDVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQTSAGADVEVQGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLLAQAEARPATDSDIEASLARVNRWNNTQKGEDPVEIRKDLQTCMQNNFSVFREGEAM
ATGLEELKVIRERLKDARLDDTSTEFNTQRIECLELENLMETAYATAVAANYRTESRGAH
ARFDFPERDDEQWLCHSIYNPETEEMSKRDVNMTPIHREAFPPKARTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagcattgcagttcgtgaatttgatgcggtagtgattggtgcaggcggtgcaggtatg
cgtgcggcactacaaatttctgagcagggtctaaagtgtgcgctgctctccaaagttttt
ccaactcgttcccacacggtgtcggcacagggcgggatcaccgttgcactgggtaactct
cacccagataactggcagtggcacatgtacgacaccgtaaaggggtctgattatatcggt
gaccaagatgccatcgagtatatgtgtaaaaatggccctaaatcagtgattgaactggag
aagatgggcttgccgttttcgcgtttcgataacgggactatctatcagcgcccgttcggc
ggccagtcgaaagagttcggtggcgaacaggcggcgcgtaccgcggcggcggcagaccgt
accggtcatgccttgctgcatacgctttaccagcaaaacgtgaagcacaaaaccacgatt
ttctccgagtggtatgcgctggacttggtgaagaaccaggatggtgcgatcttggggtgt
accgcgctttgcatggaaaccggtgagatctgctatttcaaagcgaaagcgaccatcctt
gccaccggtggtgccggccgcatttacgcgtccaccaccaatgcccacatcaatactggg
gacggtgtggggatggcactgcgtgccggtgtaccgatgcaggatatggaaatgtggcag
ttccacccaaccggtattgccggtgccggggtactggtaaccgaaggctgtcgtggtgaa
gggggctacctgcttaacaaagacggtgagcgctttatggagcgctatgcgcccaatgcc
aaagacttggcaggccgtgacgtcgttgcccgttctatgatggttgagatccgtgagggc
cgcggctgtgacggtccatgggggccgcatatcaagctgaagatggatcatctgggtaag
gatgtgctcgagtcacgtctgccgggtatctgtgaattgtcccgtacctttgcccatgtt
gatccggtcaaagagccaatcccggttattccgacttgtcactatatgatgggcggtgta
ccgacgcaggtatctggccaggctatcaagcagacttctgcgggggctgacgttgaagta
cagggcttgtttgcctgtggtgagattgcctcggtgtctgtccacggtgctaaccgcctt
ggcggtaactcactgcttgacttagtggtattcggccgtgcgaccggcctgcacttgggc
gaaactctgctggcgcaagctgaagcgcgcccagcaaccgattcagatatcgaagcgtct
ttggctcgtgtgaaccgttggaacaacacccagaaaggcgaagacccggttgagatccgt
aaagatctgcaaacttgtatgcagaataacttctcggtattccgtgaaggcgaagcaatg
gccactgggttggaagagctcaaagtgatccgtgagcgcctcaaagatgcccgccttgac
gacacctcgacagaattcaatacccagcgtattgaatgtctggagctagagaacttgatg
gaaacggcctatgccacggcggtggcggcaaactaccgtaccgaaagccgcggtgcccat
gcccgtttcgacttccctgagcgcgatgatgaacaatggctatgtcactcgatctacaac
cctgagaccgaagagatgtccaagcgtgatgtcaacatgacaccaattcatcgtgaggca
tttccgccgaaagcgcgtacatactaa

DBGET integrated database retrieval system