KEGG   Photobacterium gaetbulicola: H744_2c1256Help
Entry
H744_2c1256       CDS       T03698                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00020  Citrate cycle (TCA cycle)
pgb00190  Oxidative phosphorylation
pgb00650  Butanoate metabolism
pgb01100  Metabolic pathways
pgb01110  Biosynthesis of secondary metabolites
pgb01120  Microbial metabolism in diverse environments
pgb01130  Biosynthesis of antibiotics
pgb01200  Carbon metabolism
Module
pgb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pgb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H744_2c1256
   00650 Butanoate metabolism
    H744_2c1256
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H744_2c1256
Enzymes [BR:pgb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     H744_2c1256
    1.3.5.4  fumarate reductase (quinol)
     H744_2c1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AJR07935
UniProt: A0A0C5WXZ9
LinkDB All DBs
Position
2:1313142..1313855
Genome map
AA seq 237 aa AA seqDB search
MKLNFSIYRYNPDVDNAPHMKGYTLEVPEGSDMMVLDALILLKEQDPTLAFRRSCREGVC
GSDGINMNGKNGLACITPLSALTDQSTIVIRPLPGLPVIRDLIIDMEQFYTNYAKVKPFL
IDEGAQPPARENLQLPEERAHLDGLYECIMCACCSTSCPSFWWNPDKFIGPAGLLAAYRW
LIDSRDTATDERLSDLDDAFSVFRCHGIMNCVNVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatttctcgatttaccgctacaaccctgatgtagacaacgcgccgcacatg
aagggctacaccctagaggtgcccgaaggctccgacatgatggtgctcgatgcgcttatt
ttgctgaaagaacaagatccgaccttggcgttccgccgctcctgccgtgaaggggtctgt
ggctccgacggtatcaatatgaacggtaagaatggcctggcctgtatcacgccgctctcg
gctttgaccgatcagagcaccatagtgatccgcccgctgccgggcctgccggtgatccgt
gacttgattatcgatatggagcagttctacaccaactacgccaaagtgaagcctttcctg
attgatgagggtgctcaaccaccagcgcgcgagaacctgcagctgccggaggagcgagct
caccttgatggattgtatgaatgcattatgtgcgcctgttgttcaacctcttgtccgtca
ttctggtggaacccggataaattcatcggacctgctggcctgctagcggcttaccgctgg
ctaattgacagccgcgacacagcaacagacgaacgtttatccgatctggacgacgctttt
agcgtttttcgttgccatggcatcatgaactgtgtaaatgtttgtcctaaagggttaaat
ccgacgaaagcaattggacacattaagtcgatgttgttaaaacgtgcggtataa

DBGET integrated database retrieval system