KEGG   Photobacterium gaetbulicola: H744_2c1376Help
Entry
H744_2c1376       CDS       T03698                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pgb  Photobacterium gaetbulicola
Brite
Enzymes [BR:pgb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     H744_2c1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJR08054
UniProt: A0A0C5WSJ8
LinkDB All DBs
Position
2:complement(1454923..1455507)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYEKNALEPHISQETLEYHHGKHHNTYVVKLNGLIEGTELEEKSLEEIVKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGEVAEAINAAFGSFEAFKAKFTDSAINNFG
SSWTWLVKKADGSLDIVNTSNAGTPLTEEGVTPLLTVDLWEHAYYIDYRNLRPDYMNGFW
ALVNWDFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaactaccagctctaccttacgaaaaaaatgctcttgagccacacatctct
caggaaactcttgagtaccaccacggcaagcaccacaacacttacgtggtaaaactaaac
ggtcttatcgaaggtactgagctagaagaaaaatcactagaagaaatcgttaagacttca
acgggtggcgtattcaacaatgcagctcagatctggaaccacactttctactggcactgc
ctagcgccaaacgcaggtggcgagccaacaggcgaagttgcagaagcaatcaacgcagca
tttggttctttcgaagcgttcaaagcgaaattcactgattctgcaatcaacaacttcggc
tcttcttggacttggcttgtgaagaaggctgacggctctctagacatcgttaacacgtct
aatgctggtactccgctgactgaagaaggtgttactcctcttctaactgttgatctgtgg
gagcacgcttactacatcgattaccgcaacctacgtccagactacatgaatggtttctgg
gctctggttaactgggacttcgttgcgaagaacctagcagcctaa

DBGET integrated database retrieval system