KEGG   Photobacterium gaetbulicola: H744_2c2269Help
Entry
H744_2c2269       CDS       T03698                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00250  Alanine, aspartate and glutamate metabolism
pgb00410  beta-Alanine metabolism
pgb00650  Butanoate metabolism
pgb01100  Metabolic pathways
pgb01110  Biosynthesis of secondary metabolites
pgb01120  Microbial metabolism in diverse environments
pgb02024  Quorum sensing
Module
pgb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    H744_2c2269
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H744_2c2269
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H744_2c2269
   00430 Taurine and hypotaurine metabolism
    H744_2c2269
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    H744_2c2269
Enzymes [BR:pgb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     H744_2c2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJR08932
UniProt: A0A0C5WRF6
LinkDB All DBs
Position
2:2517492..2519153
Genome map
AA seq 553 aa AA seqDB search
MAVVDHKKADATQESLHRIFTVPEAPESTLGRIEKEISENLNVFLQTHIAAREKPLAEIE
KDFSSADIPESPSFVSDHTHFLLDKLVAQSVHTSAPTFIGHMTSALPYFLMPLSKIMIGL
NQNLVKIETSKAFTPLERQVLGMLHNLIYRENDAFYQQWMHSANHSLGAFCSGGTIANIT
ALWVARNSALKPDGDFKGVAQEGLFKAMKHYGYEDLVVLVSERGHYSLKKAADVLGLGRD
CLIPIKTDGHNRVRVDDMRAKLEELKQNQVKAFAIVGVAGTTETGNIDPLEELADLAQEY
GCHFHVDAAWGGATLMSNTYRPLLKGIERADSVTIDAHKQLYVPMGAGMVIFKNPALMTA
IEHHAEYILRKGSKDLGSHTLEGSRSGMAMLLYASLNIISRPGYEMLINTSIEKAQYFAS
LINQDSDFELISEPELCLLTYRYAPARTQEALKLADPEQREELLAALDDMTKFIQKRQRE
SGKSFVSRTRITPQAWGRRLTTVFRVVLANPLTTEQILKDVLEEQKDIAKQSLISFPKIN
TLTESILNQQVTL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagtggatcacaaaaaagccgatgcgacccaagagtcgttgcatcgcattttt
acagtgccggaagcaccagagtcgacattaggtcggatcgaaaaagagatatcagaaaac
ctgaatgtgtttttgcagacgcatattgctgcccgggagaaacccctggcagaaatcgaa
aaagacttttcctctgcggatatcccagagagtcctagctttgtttctgatcatacccat
ttcctcttggacaaactggtagcccagtcggtacatacctccgcaccgacgtttattggc
catatgacctcggccctaccctacttcttgatgccgttgtccaagatcatgatcggcctc
aatcaaaacttggtgaagatcgagacctccaaggccttcacgccgttggaacgccaggtt
ctgggaatgctgcataacctgatttaccgcgagaatgatgccttctaccagcaatggatg
cacagtgctaaccattcgctgggagcattttgctcaggagggactatcgccaacatcacc
gctctgtgggtagcacgcaacagtgcactcaaacccgatggtgattttaaaggtgtcgca
caggaaggcttgttcaaagccatgaagcattatggctatgaagatcttgtcgtactggtc
tctgaacggggtcactactcgctcaagaaagccgccgatgtccttggacttggccgagat
tgcctgatccctatcaaaaccgacggccacaaccgtgttcgggtcgatgacatgcgggcc
aagctcgaagagcttaaacagaaccaggttaaagcctttgctattgtcggggtcgctggc
accaccgaaacaggcaatatcgatccgctggaagagctcgctgatctcgctcaggaatat
ggctgccatttccacgtcgatgccgcctgggggggagcgaccctgatgtccaatacttat
aggccgttgctaaaagggatcgagcgggctgactccgtcactatcgatgcccacaagcaa
ctgtacgtgccgatgggtgccggtatggtgatcttcaaaaacccggccttgatgaccgcc
atcgagcatcacgcagagtatatcctgcgtaaaggatctaaagacttaggtagccatact
ctcgaagggtcgcgaagtggcatggcgatgttactgtatgccagcctcaacatcatcagc
cgccctggctatgaaatgctgattaataccagcatcgaaaaagcccagtacttcgcatcg
cttatcaaccaggattctgactttgaactgatctcagaacccgagctatgcctgctgact
taccgttatgcaccagcccgtactcaggaagcactgaagcttgcagatccagagcaacgc
gaagagttattggccgccctggacgatatgaccaaattcatccagaaacgccagcgtgaa
tcaggtaagtcatttgtctctcgtacccgaatcacaccgcaagcgtggggccgcaggctg
acaaccgtgttccgtgtggtactcgccaatccgctcactacggagcagattttaaaagac
gtcctcgaagaacaaaaagacatcgccaaacagagcttgatcagtttccctaagatcaac
acactgaccgagagtattctcaaccagcaagtcacgctctaa

DBGET integrated database retrieval system