KEGG   Photobacterium gaetbulicola: H744_2c2615Help
Entry
H744_2c2615       CDS       T03698                                 

Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00061  Fatty acid biosynthesis
pgb00780  Biotin metabolism
pgb01100  Metabolic pathways
pgb01212  Fatty acid metabolism
Module
pgb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    H744_2c2615
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    H744_2c2615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pgb01004]
    H744_2c2615
Enzymes [BR:pgb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     H744_2c2615
Lipid biosynthesis proteins [BR:pgb01004]
 Fatty acid synthase
  Component type
   H744_2c2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AJR09271
UniProt: A0A0C5WCA3
LinkDB All DBs
Position
2:complement(2932154..2933392)
Genome map
AA seq 412 aa AA seqDB search
MSKRRVVVTGMGMLSPVGNSVESSWKALLAGTSGISTIEHFDASAFATRFAGMVKDFNCE
EYMSKKDARKMDLFIQYGIAAGVQALKDSGIEVTEENAARIGVAIGSGIGGLGLIEANHQ
ALMEKGPRKISPFFVPSTIVNMIAGHMSIMHGLRGPNIAISTACTTGLHNIGHAARMIAY
GDADAMLAGGAEKASTPLGMGGFAAAKALSTRNDDPQGASRPWDKDRDGFVLGDGAGMMV
LEEYEHAKARGAKIYAELVGFGMSGDAYHMTSPSADGSGGALAMEAAIRDAGINADQIGY
VNAHGTSTPAGDVAETLGIKRAMGAAVDKVMVSSTKSMTGHLLGAAGSVEAIITAMTLVD
QAVPPTINLENPDEGCDLDYVPGEARQANLEYALCNSFGFGGTNGSLLFKKI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagcgtcgcgtagttgttactggcatgggtatgctatcaccggtaggtaattct
gttgaatcatcttggaaagcacttctagccggtactagcggtatcagcactattgaacat
tttgatgctagcgcattcgctactcgttttgctggtatggtcaaagacttcaactgtgaa
gaatacatgtcgaagaaagatgcccgtaaaatggatctgttcatccaatacggcattgca
gctggcgtacaagcattaaaagactctggcattgaagtcactgaagaaaacgcagcccgt
attggtgttgctatcggttctggcattggtggtcttggcttgattgaagctaaccatcag
gcactgatggaaaagggtccgcgtaagatcagcccattcttcgttccatcaacaattgta
aatatgattgctggccacatgtctatcatgcacggccttcgtggtccaaacattgcaatc
tctaccgcgtgtacaactggccttcacaacattggccatgcagcacgtatgatcgcatac
ggcgatgccgatgcgatgctagccggtggtgcagaaaaagcctcgacaccgctgggcatg
ggcggctttgccgctgctaaagcactgtctacccgtaacgatgatcctcagggcgcatct
cgtccatgggacaaagatcgtgacggtttcgtccttggtgacggtgccggtatgatggtg
ctggaagaatacgagcacgccaaagcacgtggtgcgaaaatctatgcagagcttgttggc
tttggtatgagcggcgatgcttaccacatgacatctccaagcgctgatggttctggcggt
gcattggcaatggaagcagctatccgtgatgctggtatcaatgcagaccagatcggctac
gtgaatgctcacggtacatcgactccagctggtgacgttgctgaaacgctaggtatcaag
cgtgcaatgggcgcagcagtcgataaagtgatggtgtcttctaccaagtcgatgactggc
cacctgttgggtgcggctggttctgttgaagctatcattactgctatgacgctggttgat
caggctgttccgccaacaatcaacctagaaaaccctgatgaaggctgtgatctggactac
gtaccaggtgaagcccgtcaggcaaatcttgagtacgcactgtgtaactctttcggtttc
ggtggtacaaacggctcattgctgttcaagaaaatctaa

DBGET integrated database retrieval system