KEGG   Photobacterium gaetbulicola: H744_2c2767Help
Entry
H744_2c2767       CDS       T03698                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00220  Arginine biosynthesis
pgb00250  Alanine, aspartate and glutamate metabolism
pgb00290  Valine, leucine and isoleucine biosynthesis
pgb01100  Metabolic pathways
pgb01110  Biosynthesis of secondary metabolites
pgb01130  Biosynthesis of antibiotics
pgb01210  2-Oxocarboxylic acid metabolism
pgb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H744_2c2767
   00290 Valine, leucine and isoleucine biosynthesis
    H744_2c2767
   00220 Arginine biosynthesis
    H744_2c2767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pgb01007]
    H744_2c2767
Enzymes [BR:pgb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     H744_2c2767
    2.6.1.66  valine---pyruvate transaminase
     H744_2c2767
Amino acid related enzymes [BR:pgb01007]
 Aminotransferase (transaminase)
  Class I
   H744_2c2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJR09421
UniProt: A0A0C5WCJ4
LinkDB All DBs
Position
2:3111519..3112733
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLNNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQKRGMLDLDVEDVYIGNGVSELIVMAMQALLNNND
EMLVPAPDYPLWTAAVSLSGGKAVHYTCDEQADWYPDLDDIRSKITPNTRGIVLINPNNP
TGAVYSRDFLLEVVEIARQHKLIIFADEIYDKILYEGAQHTSIAPLAEDVFCVTFNGLSK
SYRVCGFRAGWMVLSGPKHLAKSYIEGLEMLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAYDLLTSIPGVSCVKPKGALYLFPKLDQKKFNIIDDQRFALDFLQQEK
VLVVHGTGFNWKQPDHFRIVTLPRVDDLEMAIGRLERFLHNYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacatcgggatgtcatcaaaactcaataatgtctgttacgacattcgaggtccc
gttctgaaacatgccaagcgcatggaagaggaagggcacaagattctcaaactcaatatc
ggcaaccctgctccgttcggttttgatgcccctgatgaaattttggtggatgtgatccgt
aacctgccgacttctcagggttactgtgactccaagggcatttactcggcccgaaaagcg
gtcgtccagcattaccagaaacgcggcatgctcgacctggacgtggaagatgtctacatc
ggcaacggtgtctccgagctgatcgtaatggcgatgcaggcactgctcaataacaacgac
gaaatgttggtgccagcccctgactacccgctgtggacagcagccgtatccctgtccggc
ggtaaggcagtgcactatacctgtgacgagcaagccgactggtatccggatttagacgat
atccgcagcaaaattacgccgaacacccgcgggattgtgctgatcaacccgaacaaccca
accggtgcggtttacagccgtgacttcctgctggaagtggtggaaatcgcccgccagcac
aagctaattattttcgccgacgagatctacgacaagatcctctacgaaggtgcgcaacat
acctcgattgccccactggccgaagacgtcttctgcgttaccttcaacggcctgtcaaag
tcctaccgggtttgtggcttccgtgccggctggatggtgctttctggccctaagcacctg
gcgaagagttatatcgaaggattggagatgctctcgtcgatgcgcctgtgcgccaacgtg
ccgatgcaacatgctatccagacggcgctgggtggctaccagagtatcaatgagctgatc
ctgccgggtggccgtttgctggagcaacgcgaccgggcctatgacttattgacctctatc
ccgggcgtatcctgcgtcaaaccgaaaggcgcgctttacctgttcccgaaactggatcag
aaaaaattcaacatcattgatgaccagcgcttcgcactggacttcctccagcaggaaaaa
gtcttggtggtacacggcaccgggtttaactggaagcaaccggaccacttccgtatcgtc
accctgccgcgggttgatgacttggaaatggcgataggccgcttggagcgattcctccat
aactaccgccagtaa

DBGET integrated database retrieval system